| UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
|
|||||||
|
Kinase Fusion Gene:MARK1_RHOU |
Kinase Fusion Protein Summary |
 Kinase Fusion gene summary |
| Kinase Fusion partner gene information | Kinase Fusion gene name: MARK1_RHOU | KinaseFusionDB ID: KFG3621 | FusionGDB2.0 ID: KFG3621 | Hgene | Tgene | Gene symbol | MARK1 | RHOU | Gene ID | 4139 | 58480 | |
| Gene name | microtubule affinity regulating kinase 1 | ras homolog family member U | ||||||||||
| Synonyms | MARK|Par-1c|Par1c | ARHU|CDC42L1|G28K|WRCH1|hG28K | ||||||||||
| Cytomap | 1q41 | 1q42.13 | ||||||||||
| Type of gene | protein-coding | protein-coding | ||||||||||
| Description | serine/threonine-protein kinase MARK1MAP/microtubule affinity-regulating kinase 1PAR1 homolog c | rho-related GTP-binding protein RhoU2310026M05RikCDC42-like GTPase 1GTP-binding protein SB128GTP-binding protein like 1Ryu GTPaseras homolog gene family, member Uras-like gene family member Urho GTPase-like protein ARHUwnt-1 responsive Cdc42 homo | ||||||||||
| Modification date | 20240403 | 20240407 | ||||||||||
| UniProtAcc | Q9P0L2 | Q7L0Q8 | ||||||||||
| Ensembl transtripts involved in fusion gene | ENST ids | ENST00000366917, ENST00000366918, ENST00000402574, ENST00000485104, | ENST00000493528, ENST00000366691, | |||||||||
| Context (manual curation of fusion genes in KinaseFusionDB) | PubMed: MARK1 [Title/Abstract] AND RHOU [Title/Abstract] AND fusion [Title/Abstract] | |||||||||||
| Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) | MARK1(220826694)-RHOU(228873420), # samples:2 MARK1(220831176)-RHOU(228873420), # samples:2 | |||||||||||
| Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Partner | Gene | GO ID | GO term | PubMed ID |
| Hgene | MARK1 | GO:0006468 | protein phosphorylation | 14976552 |
| Hgene | MARK1 | GO:0010628 | positive regulation of gene expression | 31281935 |
| Hgene | MARK1 | GO:0010629 | negative regulation of gene expression | 31281935 |
| Hgene | MARK1 | GO:0010719 | negative regulation of epithelial to mesenchymal transition | 31281935 |
| Hgene | MARK1 | GO:0035556 | intracellular signal transduction | 14976552 |
| Kinase Fusion gene breakpoints across MARK1 (5'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
 |
| Kinase Fusion gene breakpoints across RHOU (3'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
 |
Top |
Kinase Fusion Gene Sample Information |
| Kinase Fusion gene information. |
| Kinase Fusion gene information from four resources (ChiTars 5.0, ChimerDB 4.0, COSMIC, and CCLE) * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
| Source | Sample | Hgene | Hchr | Hbp | Tgene | Tchr | Tbp |
| ChimerDB4 | TCGA-EE-A29D-06A | MARK1 | chr1 | 220826694 | RHOU | chr1 | 228873420 |
| ChimerDB4 | TCGA-EE-A29D-06A | MARK1 | chr1 | 220826694 | RHOU | chr1 | 228879032 |
| ChimerDB4 | TCGA-EE-A29D-06A | MARK1 | chr1 | 220831176 | RHOU | chr1 | 228873420 |
Top |
Kinase Fusion ORF Analysis |
| Kinase Fusion information from ORFfinder translation from full-length transcript sequence from KinaseFusionDB. |
| Henst | Tenst | Hgene | Hchr | Hbp | Tgene | Tchr | Tbp | Seq length (transcript) | Seq length (amino acids) |
| ENST00000402574 | ENST00000366691 | MARK1 | chr1 | 220826694 | RHOU | chr1 | 228879032 | 5970 | 745 |
Top |
Kinase Fusion Amino Acid Sequences |
| For individual full-length fusion transcript sequence from KinaseFusionDB, we ran ORFfinder and chose the longest ORF among the all predicted ones. |
| >Henst_Tenst_Hgene_Hchr_Hbp_Tgene_Tchr_Tbp_length(fusion AA)_AAseq >ENST00000402574_ENST00000366691_MARK1_chr1_220826694_RHOU_chr1_228879032_length(amino acids)=745 MSAYPGGAAAGSGSPSSSSASSSLFPPPGPLVAPPRGLREPLAPALCSRPHPFPVAPRGPHHSPAGETPARPRCPHKMSARTPLPTVNER DTENHTSVDGYTEPHIQPTKSSSRQNIPRCRNSITSATDEQPHIGNYRLQKTIGKGNFAKVKLARHVLTGREVAVKIIDKTQLNPTSLQK LFREVRIMKILNHPNIVKLFEVIETEKTLYLVMEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKYIVHRDLKAENLLLDGD MNIKIADFGFSNEFTVGNKLDTFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTD CENLLKKLLVLNPIKRGSLEQIMKDRWMNVGHEEEELKPYTEPDPDFNDTKRIDIMVTMGFARDEINDALINQKYDEVMATYILLGRKPP EFEGGESLSSGNLCQRSRPSSDLNNSTLQSPAHLKVQRSISANQKQRRFSDHAGPSIPPAVSYTKRPQANSVESEQKEEWDKDVARKLGS TTVGSKSEMTASPLVGPERKKSSTIPSNNVYSGGSMARRNTYVCERTTDRYVALQNGKDSSLTEMSVSSISSAGSSVASAVPSARPRHQK SMSTSGHPIKVTLPTIKDGSEAYRPGTTQRVPAASPSAHSISTATPDRTRFPRGSSSRSTFHGEQLRERRSVAYNGPPASPSHETGAFAH -------------------------------------------------------------- |
Multiple Sequence Alignment of All Fusion Protein Isoforms |
Top |
Kinase Fusion Protein Functional Features |
| Four levels of functional features of fusion genes Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr1:220826694/chr1:228873420) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
 |
| Main function of each fusion partner protein. (from UniProt) |
| Hgene | Tgene |
| MARK1 | RHOU |
| FUNCTION: Serine/threonine-protein kinase (PubMed:23666762). Involved in cell polarity and microtubule dynamics regulation. Phosphorylates DCX, MAP2 and MAP4. Phosphorylates the microtubule-associated protein MAPT/TAU (PubMed:23666762). Involved in cell polarity by phosphorylating the microtubule-associated proteins MAP2, MAP4 and MAPT/TAU at KXGS motifs, causing detachment from microtubules, and their disassembly. Involved in the regulation of neuronal migration through its dual activities in regulating cellular polarity and microtubule dynamics, possibly by phosphorylating and regulating DCX. Also acts as a positive regulator of the Wnt signaling pathway, probably by mediating phosphorylation of dishevelled proteins (DVL1, DVL2 and/or DVL3). {ECO:0000269|PubMed:11433294, ECO:0000269|PubMed:17573348, ECO:0000269|PubMed:23666762}. | FUNCTION: Acts upstream of PAK1 to regulate the actin cytoskeleton, adhesion turnover and increase cell migration. Stimulates quiescent cells to reenter the cell cycle. Has no detectable GTPase activity but its high intrinsic guanine nucleotide exchange activity suggests it is constitutively GTP-bound. Plays a role in the regulation of cell morphology and cytoskeletal organization. Required in the control of cell shape. {ECO:0000269|PubMed:11459829, ECO:0000269|PubMed:16472646, ECO:0000269|PubMed:17620058, ECO:0000269|PubMed:18086875, ECO:0000269|PubMed:21834987}. |
| Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
| - Retained domain in the 5'-partner of fusion protein (protein functional feature from UniProt). |
| Partner | Hgeneene | Hbp | Tgeneene | Tbp | ENST | BPexon | TotalExon | Protein feature loci | BPloci | TotalLen | Feature | Note |
| Hgene | MARK1 | 220826694 | RHOU | 228879032 | ENST00000402574 | 15 | 16 | 60_311 | 6401 | 759 | Domain | Note=Protein kinase;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00159 |
| Hgene | MARK1 | 220826694 | RHOU | 228879032 | ENST00000402574 | 16 | 17 | 60_311 | 5271 | 646 | Domain | Note=Protein kinase;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00159 |
| Hgene | MARK1 | 220826694 | RHOU | 228879032 | ENST00000402574 | 16 | 18 | 60_311 | 6621 | 796 | Domain | Note=Protein kinase;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00159 |
| Hgene | MARK1 | 220826694 | RHOU | 228879032 | ENST00000402574 | 15 | 16 | 325_370 | 6401 | 759 | Domain | Note=UBA;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00212 |
| Hgene | MARK1 | 220826694 | RHOU | 228879032 | ENST00000402574 | 16 | 17 | 325_370 | 5271 | 646 | Domain | Note=UBA;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00212 |
| Hgene | MARK1 | 220826694 | RHOU | 228879032 | ENST00000402574 | 16 | 18 | 325_370 | 6621 | 796 | Domain | Note=UBA;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00212 |
| - Retained domain in the 3'-partner of fusion protein (protein functional feature from UniProt). |
| Partner | Hgeneene | Hbp | Tgeneene | Tbp | ENST | BPexon | TotalExon | Protein feature loci | BPloci | TotalLen | Feature | Note |
Top |
Kinase Fusion Protein Structures |
| CIF files of the predicted kinase fusion proteins * Here we show the 3D structure of the fusion proteins using Mol*. AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Model confidence is shown from the pLDDT values per residue. pLDDT corresponds to the model’s prediction of its score on the local Distance Difference Test. It is a measure of local accuracy (from AlphfaFold website). To color code individual residues, we transformed individual PDB files into CIF format. |
| Kinase Fusion protein CIF link (fusion AA seq ID in KinaseFusionDB) | Henst | Tenst | Hgene | Hchr | Hbp | Tgene | Tchr | Tbp | AA seq | Len(AA seq) |
| PDB file >>>163_MARK1_RHOU | ENST00000402574 | ENST00000366691 | MARK1 | chr1 | 220826694 | RHOU | chr1 | 228879032 | MSAYPGGAAAGSGSPSSSSASSSLFPPPGPLVAPPRGLREPLAPALCSRPHPFPVAPRGPHHSPAGETPARPRCPHKMSARTPLPTVNER DTENHTSVDGYTEPHIQPTKSSSRQNIPRCRNSITSATDEQPHIGNYRLQKTIGKGNFAKVKLARHVLTGREVAVKIIDKTQLNPTSLQK LFREVRIMKILNHPNIVKLFEVIETEKTLYLVMEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKYIVHRDLKAENLLLDGD MNIKIADFGFSNEFTVGNKLDTFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTD CENLLKKLLVLNPIKRGSLEQIMKDRWMNVGHEEEELKPYTEPDPDFNDTKRIDIMVTMGFARDEINDALINQKYDEVMATYILLGRKPP EFEGGESLSSGNLCQRSRPSSDLNNSTLQSPAHLKVQRSISANQKQRRFSDHAGPSIPPAVSYTKRPQANSVESEQKEEWDKDVARKLGS TTVGSKSEMTASPLVGPERKKSSTIPSNNVYSGGSMARRNTYVCERTTDRYVALQNGKDSSLTEMSVSSISSAGSSVASAVPSARPRHQK SMSTSGHPIKVTLPTIKDGSEAYRPGTTQRVPAASPSAHSISTATPDRTRFPRGSSSRSTFHGEQLRERRSVAYNGPPASPSHETGAFAH | 745 |
| 3D view using mol* of 163_MARK1_RHOU | ||||||||||
| PDB file >>>HKFP_237_MARK1_RHOU | ENST00000402574 | ENST00000366691 | MARK1 | chr1 | 220826694 | RHOU | chr1 | 228879032 | MSAYPGGAAAGSGSPSSSSASSSLFPPPGPLVAPPRGLREPLAPALCSRPHPFPVAPRGPHHSPAGETPARPRCPHKMSARTPLPTVNER DTENHTSVDGYTEPHIQPTKSSSRQNIPRCRNSITSATDEQPHIGNYRLQKTIGKGNFAKVKLARHVLTGREVAVKIIDKTQLNPTSLQK LFREVRIMKILNHPNIVKLFEVIETEKTLYLVMEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKYIVHRDLKAENLLLDGD MNIKIADFGFSNEFTVGNKLDTFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTD CENLLKKLLVLNPIKRGSLEQIMKDRWMNVGHEEEELKPYTEPDPDFNDTKRIDIMVTMGFARDEINDALINQKYDEVMATYILLGRKPP EFEGGESLSSGNLCQRSRPSSDLNNSTLQSPAHLKVQRSISANQKQRRFSDHAGPSIPPAVSYTKRPQANSVESEQKEEWDKDVARKLGS TTVGSKSEMTASPLVGPERKKSSTIPSNNVYSGGSMARRNTYVCERTTDRYVALQNGKDSSLTEMSVSSISSAGSSVASAVPSARPRHQK SMSTSGHPIKVTLPTIKDGSEAYRPGTTQRVPAASPSAHSISTATPDRTRFPRGSSSRSTFHGEQLRERRSVAYNGPPASPSHETGAFAH | 745_MARK1_RHOU |
Top |
Comparison of Fusion Protein Isoforms |
| Superimpose the 3D Structures Among All Fusion Protein Isoforms * Download the pdb file and open it from the molstar online viewer. |
| Comparison of the Secondary Structures of Fusion Protein Isoforms |
Top |
Comparison of Fusion Protein Sequences/Structures with Known Sequences/Structures from PDB |
Top |
pLDDT score distribution |
| pLDDT score distribution of the predicted fusion protein structures from AlphaFold2 * AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. * The blue color at the bottom marks the best active site residues. |
Top |
Potential Active Site Information |
| The potential binding sites of these fusion proteins were identified using SiteMap, a module of the Schrodinger suite. |
| Kinase Fusion AA seq ID in KinaseFusionDB | Site score | Size | Dscore | Volume | Exposure | Enclosure | Contact | Phobic | Philic | Balance | Don/Acc | Residues |
Top |
Ramachandran Plot of Kinase Fusion Protein Structure |
| Ramachandran plot of the torsional angles - phi (φ)and psi (ψ) - of the residues (amino acids) contained in this fusion protein peptide. |
| 163_MARK1_RHOU_ramachandran.png |
 |
Top |
Virtual Screening Results |
| Distribution of the average docking score across all approved kinase inhibitors. Distribution of the number of occurrence across all approved kinase inhibitors. |
| 5'-kinase fusion protein case |
| 3'-kinase fusion protein case |
Top |
| Drug information from DrugBank of the top 20 interacting small molecules. * The detailed information of individual kinase inhibitors are available in the download page. |
| Fusion gene name info | Drug | Docking score | Glide g score | Glide energy |
Top |
Kinase-Substrate Information of MARK1_RHOU |
| Phosphorylation target of the kinase (phosphosite, 03-17-2024) |
| Kinase | Kinase UniProt Acc | Kinase species | Substrate | Substrate UniProt Acc | Substrate phosphorylated residues | Substrate phosphorylated sites (+/-7AA) | Domain |
| MARK1 | Q9P0L2 | human | MAPT | P10636-8 | T231 | KKVAVVRtPPKsPss | |
| MARK1 | Q9P0L2 | human | MAPT | P10636-8 | S320 | VDLskVTskCGsLGN | Tubulin-binding |
| MARK1 | Q9P0L2 | human | MAPT | P10636-8 | S396 | GAEIVyKsPVVsGDt | |
| MARK1 | Q9P0L2 | human | MAPT | P10636-8 | S262 | NVKskIGstENLkHQ | Tubulin-binding |
| MARK1 | Q9P0L2 | human | MAPT | P10636-8 | S324 | kVTskCGsLGNIHHk | Tubulin-binding |
| MARK1 | Q9P0L2 | human | MAPT | P10636-8 | S293 | NVQskCGsKDNIkHV | Tubulin-binding |
| MARK1 | Q9P0L2 | human | TNK1 | Q13470 | S502 | RMKGIsRsLEsVLsL | |
| MARK1 | Q9P0L2 | human | DIXDC1 | Q155Q3-2 | S381 | SKLPHSQsSPTVSST | |
| MARK1 | Q9P0L2 | human | MAPT | P10636-8 | S356 | rVQskIGsLDNItHV | Tubulin-binding |
| MARK1 | Q9P0L2 | human | FEZ1 | Q99689 | S58 | SEIISFKsMEDLVNE | FEZ |
| MARK1 | Q9P0L2 | human | DIXDC1 | Q155Q3 | S592 | SKLPHsQssPTVSST | |
| MARK1 | Q9P0L2 | human | MAPT | P10636-8 | S422 | GsIDMVDsPQLAtLA | |
| MARK1 | Q9P0L2 | human | MAPT | P10636-8 | S305 | kHVPGGGsVQIVykP | Tubulin-binding |
| Biological Network Integration of This Kinase and Substrates (GeneMANIA website) |
| Enriched GO biological processes of the phosphorylation target genes of the kinase |
| Kinase | GOID | GO term | P.adjust |
| MARK1 | ID | Description | 0.00e+00 |
| MARK1 | GO:0019896 | axonal transport of mitochondrion | 5.74e-04 |
| MARK1 | GO:0032886 | regulation of microtubule-based process | 5.74e-04 |
| MARK1 | GO:0034643 | establishment of mitochondrion localizatio | 1.09e-05 |
| MARK1 | GO:0051654 | establishment of mitochondrion localization | 6.15e-04 |
| MARK1 | GO:0051646 | mitochondrion localization | 1.44e-03 |
| MARK1 | GO:0098930 | axonal transport | 2.09e-03 |
| MARK1 | GO:0008088 | axo-dendritic transport | 2.57e-03 |
| MARK1 | GO:0072384 | organelle transport along microtubule | 3.06e-03 |
| MARK1 | GO:0070507 | regulation of microtubule cytoskeleton organization | 9.01e-03 |
| MARK1 | GO:0010970 | transport along microtubule | 9.46e-03 |
| MARK1 | GO:0021543 | pallium development | 1.06e-02 |
| MARK1 | GO:0030705 | cytoskeleton-dependent intracellular transport | 1.13e-02 |
| MARK1 | GO:0099111 | microtubule-based transport | 1.13e-02 |
| MARK1 | GO:0021537 | telencephalon development | 1.76e-02 |
| MARK1 | GO:0010506 | regulation of autophagy | 2.39e-02 |
| MARK1 | GO:0031346 | positive regulation of cell projection organization | 2.39e-02 |
| MARK1 | GO:1902513 | regulation of organelle transport along microtubule | 2.39e-02 |
| MARK1 | GO:0010639 | negative regulation of organelle organization | 2.39e-02 |
| MARK1 | GO:0010917 | negative regulation of mitochondrial membrane potential | 2.44e-02 |
| MARK1 | GO:0045837 | negative regulation of membrane potential | 2.44e-02 |
| MARK1 | GO:0030900 | forebrain development | 2.44e-02 |
| MARK1 | GO:1902902 | negative regulation of autophagosome assembly | 2.44e-02 |
| MARK1 | GO:0007018 | microtubule-based movement | 2.44e-02 |
| MARK1 | GO:1900452 | regulation of long-term synaptic depression | 2.44e-02 |
| MARK1 | GO:0007409 | axonogenesis | 2.44e-02 |
| MARK1 | GO:0010975 | regulation of neuron projection development | 2.44e-02 |
| MARK1 | GO:0032930 | positive regulation of superoxide anion generation | 2.44e-02 |
| MARK1 | GO:1900034 | regulation of cellular response to heat | 2.44e-02 |
| MARK1 | GO:0051656 | establishment of organelle localization | 2.44e-02 |
| MARK1 | GO:0048311 | mitochondrion distribution | 2.44e-02 |
| MARK1 | GO:0032928 | regulation of superoxide anion generation | 2.64e-02 |
| MARK1 | GO:0010288 | response to lead ion | 2.67e-02 |
| MARK1 | GO:0070584 | mitochondrion morphogenesis | 2.67e-02 |
| MARK1 | GO:0090043 | regulation of tubulin deacetylation | 2.67e-02 |
| MARK1 | GO:1902473 | regulation of protein localization to synapse | 2.72e-02 |
| MARK1 | GO:0090042 | tubulin deacetylation | 2.76e-02 |
| MARK1 | GO:0070841 | inclusion body assembly | 2.81e-02 |
| MARK1 | GO:0048143 | astrocyte activation | 2.85e-02 |
| MARK1 | GO:0090218 | positive regulation of lipid kinase activity | 2.89e-02 |
| MARK1 | GO:0021846 | cell proliferation in forebrain | 2.93e-02 |
| MARK1 | GO:0090140 | regulation of mitochondrial fission | 3.02e-02 |
| MARK1 | GO:0034063 | stress granule assembly | 3.02e-02 |
| MARK1 | GO:0090322 | regulation of superoxide metabolic process | 3.02e-02 |
| MARK1 | GO:0016242 | negative regulation of macroautophagy | 3.02e-02 |
| MARK1 | GO:0031116 | positive regulation of microtubule polymerization | 3.02e-02 |
| MARK1 | GO:0060292 | long-term synaptic depression | 3.02e-02 |
| MARK1 | GO:0090311 | regulation of protein deacetylation | 3.20e-02 |
| MARK1 | GO:0021799 | cerebral cortex radially oriented cell migration | 3.20e-02 |
| MARK1 | GO:0031112 | positive regulation of microtubule polymerization or depolymerization | 3.20e-02 |
Top |
Related Drugs to MARK1_RHOU |
| Drugs used for this fusion-positive patient. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
| Hgene | Tgene | Drug | Source | PMID |
| Distribution of the number of studies mentioning MARK1-RHOU and kinase inhibitors the PubMed Abstract (04-01-2024) |
| Fusion gene - drug pair 1 | Fusion gene - drug pair 2 | PMID | Publication date | DOI | Study title |
Top |
Related Diseases to MARK1_RHOU |
| Diseases that have this fusion gene. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
| Hgene | Tgene | Disease | Source | PMID |
| Related diseases from the literature mentioned this fusion gene and drug. (PubMed, 04-01-2024) |
| MeSH ID | MeSH term |
| Diseases associated with fusion partners. (DisGeNet 4.0) |
| Partner | Gene | Disease ID | Disease name | # pubmeds | Source |
Top |
Clinical Trials of the Found Drugs/Small Molecules |
| Statistics of the Clinical Trials of the Found Kinase Inibitors from clinicaltrials.gov (06-17-2024) |
| Clinical Trials from clinicaltrials.gov (06-17-2024) |
| Fusion Gene | Kinase Inhibitor | NCT ID | Study Status | Phases | Disease | # Enrolment | Date |
Copyright 2024-Present -The University of Texas Health Science Center at Houston
Web File Viewing | Emergency Information |Campus Carry|Site Policies |