UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
|
Kinase Fusion Gene:MARK2_BUB1B |
Kinase Fusion Protein Summary |
Kinase Fusion gene summary |
Kinase Fusion partner gene information | Kinase Fusion gene name: MARK2_BUB1B | KinaseFusionDB ID: KFG3625 | FusionGDB2.0 ID: KFG3625 | Hgene | Tgene | Gene symbol | MARK2 | BUB1B | Gene ID | 2011 | 701 | |
Gene name | microtubule affinity regulating kinase 2 | BUB1 mitotic checkpoint serine/threonine kinase B | ||||||||||
Synonyms | EMK-1|EMK1|PAR-1|Par-1b|Par1b | BUB1beta|BUBR1|Bub1A|MAD3L|MVA1|SSK1|hBUBR1 | ||||||||||
Cytomap | 11q13.1 | 15q15.1 | ||||||||||
Type of gene | protein-coding | protein-coding | ||||||||||
Description | serine/threonine-protein kinase MARK2ELKL motif kinase 1MAP/microtubule affinity-regulating kinase 2PAR1 homolog bSer/Thr protein kinase PAR-1Bserine/threonine protein kinase EMKtesticular tissue protein Li 117 | mitotic checkpoint serine/threonine-protein kinase BUB1 betaBUB1B, mitotic checkpoint serine/threonine kinaseMAD3/BUB1-related protein kinasebudding uninhibited by benzimidazoles 1 homolog betamitotic checkpoint kinase MAD3L | ||||||||||
Modification date | 20240407 | 20240305 | ||||||||||
UniProtAcc | Q7KZI7 | O60566 | ||||||||||
Ensembl transtripts involved in fusion gene | ENST ids | ENST00000315032, ENST00000350490, ENST00000361128, ENST00000377809, ENST00000402010, ENST00000413835, ENST00000502399, ENST00000508192, ENST00000377810, ENST00000408948, ENST00000425897, ENST00000509502, ENST00000513765, | ENST00000560120, ENST00000287598, ENST00000412359, | |||||||||
Context (manual curation of fusion genes in KinaseFusionDB) | PubMed: MARK2 [Title/Abstract] AND BUB1B [Title/Abstract] AND fusion [Title/Abstract] | |||||||||||
Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) | MARK2(63607032)-BUB1B(40468678), # samples:3 |
Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
Partner | Gene | GO ID | GO term | PubMed ID |
Hgene | MARK2 | GO:0006468 | protein phosphorylation | 14976552 |
Hgene | MARK2 | GO:0010976 | positive regulation of neuron projection development | 12429843 |
Hgene | MARK2 | GO:0018105 | peptidyl-serine phosphorylation | 10542369|16717194 |
Hgene | MARK2 | GO:0030010 | establishment of cell polarity | 12429843 |
Hgene | MARK2 | GO:0035556 | intracellular signal transduction | 14976552 |
Hgene | MARK2 | GO:0045197 | establishment or maintenance of epithelial cell apical/basal polarity | 15324659 |
Hgene | MARK2 | GO:0070507 | regulation of microtubule cytoskeleton organization | 10542369 |
Tgene | BUB1B | GO:0007094 | mitotic spindle assembly checkpoint signaling | 10477750 |
Kinase Fusion gene breakpoints across MARK2 (5'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Kinase Fusion gene breakpoints across BUB1B (3'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Top |
Kinase Fusion Gene Sample Information |
Kinase Fusion gene information. |
Kinase Fusion gene information from four resources (ChiTars 5.0, ChimerDB 4.0, COSMIC, and CCLE) * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
Source | Sample | Hgene | Hchr | Hbp | Tgene | Tchr | Tbp |
ChimerDB4 | TCGA-94-7557-01A | MARK2 | chr11 | 63607032 | BUB1B | chr15 | 40468678 |
ChimerDB4 | TCGA-94-7557 | MARK2 | chr11 | 63607032 | BUB1B | chr15 | 40468677 |
ChimerDB4 | TCGA-94-7557 | MARK2 | chr11 | 63607032 | BUB1B | chr15 | 40468584 |
Top |
Kinase Fusion ORF Analysis |
Kinase Fusion information from ORFfinder translation from full-length transcript sequence from KinaseFusionDB. |
Henst | Tenst | Hgene | Hchr | Hbp | Tgene | Tchr | Tbp | Seq length (transcript) | Seq length (amino acids) |
ENST00000377809 | ENST00000287598 | MARK2 | chr11 | 63607032 | BUB1B | chr15 | 40468678 | 3779 | 940 |
ENST00000377809 | ENST00000287598 | MARK2 | chr11 | 63607032 | BUB1B | chr15 | 40468677 | 3779 | 940 |
Top |
Kinase Fusion Amino Acid Sequences |
For individual full-length fusion transcript sequence from KinaseFusionDB, we ran ORFfinder and chose the longest ORF among the all predicted ones. |
>Henst_Tenst_Hgene_Hchr_Hbp_Tgene_Tchr_Tbp_length(fusion AA)_AAseq >ENST00000377809_ENST00000287598_MARK2_chr11_63607032_BUB1B_chr15_40468678_length(amino acids)=940 MSSARTPLPTLNERDTEQGRLCNEPLDMYSYLHNQGIGVSLAQFYISWAEEYEARENFRKADAIFQEGIQQKAEPLERLQSQHRQFQARV SRQTLLALEKEEEEEVFESSVPQRSTLAELKSKGKKTARAPIIRVGGALKAPSQNRGLQNPFPQQMQNNSRITVFDENADEASTAELSKP TVQPWIAPPMPRAKENELQAGPWNTGRSLEHRPRGNTASLIAVPAVLPSFTPYVEETARQPVMTPCKIEPSINHILSTRKPGKEEGDPLQ RVQSHQQASEEKKEKMMYCKEKIYAGVGEFSFEEIRAEVFRKKLKEQREAELLTSAEKRAEMQKQIEEMEKKLKEIQTTQQERTGDQQEE TMPTKETTKLQIASESQKIPGMTLSSSVCQVNCCARETSLAENIWQEQPHSKGPSVPFSIFDEFLLSEKKNKSPPADPPRVLAQRRPLAV LKTSESITSNEDVSPDVCDEFTGIEPLSEDAIITGFRNVTICPNPEDTCDFARAARFVSTPFHEIMSLKDLPSDPERLLPEEDLDVKTSE DQQTACGTIYSQTLSIKKLSPIIEDSREATHSSGFSGSSASVASTSSIKCLQIPEKLELTNETSENPTQSPWCSQYRRQLLKSLPELSAS AELCIEDRPMPKLEIEKEIELGNEDYCIKREYLICEDYKLFWVAPRNSAELTVIKVSSQPVPWDFYINLKLKERLNEDFDHFCSCYQYQD GCIVWHQYINCFTLQDLLQHSEYITHEITVLIIYNLLTIVEMLHKAEIVHGDLSPRCLILRNRIHDPYDCNKNNQALKIVDFSYSVDLRV QLDVFTLSGFRTVQILEGQKILANCSSPYQVDLFGIADLAHLLLFKEHLQVFWDGSFWKLSQNISELKDGELWNKFFVRILNANDEATVS -------------------------------------------------------------- >ENST00000377809_ENST00000287598_MARK2_chr11_63607032_BUB1B_chr15_40468677_length(amino acids)=940 MSSARTPLPTLNERDTEQGRLCNEPLDMYSYLHNQGIGVSLAQFYISWAEEYEARENFRKADAIFQEGIQQKAEPLERLQSQHRQFQARV SRQTLLALEKEEEEEVFESSVPQRSTLAELKSKGKKTARAPIIRVGGALKAPSQNRGLQNPFPQQMQNNSRITVFDENADEASTAELSKP TVQPWIAPPMPRAKENELQAGPWNTGRSLEHRPRGNTASLIAVPAVLPSFTPYVEETARQPVMTPCKIEPSINHILSTRKPGKEEGDPLQ RVQSHQQASEEKKEKMMYCKEKIYAGVGEFSFEEIRAEVFRKKLKEQREAELLTSAEKRAEMQKQIEEMEKKLKEIQTTQQERTGDQQEE TMPTKETTKLQIASESQKIPGMTLSSSVCQVNCCARETSLAENIWQEQPHSKGPSVPFSIFDEFLLSEKKNKSPPADPPRVLAQRRPLAV LKTSESITSNEDVSPDVCDEFTGIEPLSEDAIITGFRNVTICPNPEDTCDFARAARFVSTPFHEIMSLKDLPSDPERLLPEEDLDVKTSE DQQTACGTIYSQTLSIKKLSPIIEDSREATHSSGFSGSSASVASTSSIKCLQIPEKLELTNETSENPTQSPWCSQYRRQLLKSLPELSAS AELCIEDRPMPKLEIEKEIELGNEDYCIKREYLICEDYKLFWVAPRNSAELTVIKVSSQPVPWDFYINLKLKERLNEDFDHFCSCYQYQD GCIVWHQYINCFTLQDLLQHSEYITHEITVLIIYNLLTIVEMLHKAEIVHGDLSPRCLILRNRIHDPYDCNKNNQALKIVDFSYSVDLRV QLDVFTLSGFRTVQILEGQKILANCSSPYQVDLFGIADLAHLLLFKEHLQVFWDGSFWKLSQNISELKDGELWNKFFVRILNANDEATVS -------------------------------------------------------------- |
Multiple Sequence Alignment of All Fusion Protein Isoforms |
Top |
Kinase Fusion Protein Functional Features |
Four levels of functional features of fusion genes Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr11:63607032/chr15:40468678) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
Main function of each fusion partner protein. (from UniProt) |
Hgene | Tgene |
MARK2 | BUB1B |
FUNCTION: Serine/threonine-protein kinase (PubMed:23666762). Involved in cell polarity and microtubule dynamics regulation. Phosphorylates CRTC2/TORC2, DCX, HDAC7, KIF13B, MAP2, MAP4 and RAB11FIP2. Phosphorylates the microtubule-associated protein MAPT/TAU (PubMed:23666762). Plays a key role in cell polarity by phosphorylating the microtubule-associated proteins MAP2, MAP4 and MAPT/TAU at KXGS motifs, causing detachment from microtubules, and their disassembly. Regulates epithelial cell polarity by phosphorylating RAB11FIP2. Involved in the regulation of neuronal migration through its dual activities in regulating cellular polarity and microtubule dynamics, possibly by phosphorylating and regulating DCX. Regulates axogenesis by phosphorylating KIF13B, promoting interaction between KIF13B and 14-3-3 and inhibiting microtubule-dependent accumulation of KIF13B. Also required for neurite outgrowth and establishment of neuronal polarity. Regulates localization and activity of some histone deacetylases by mediating phosphorylation of HDAC7, promoting subsequent interaction between HDAC7 and 14-3-3 and export from the nucleus. Also acts as a positive regulator of the Wnt signaling pathway, probably by mediating phosphorylation of dishevelled proteins (DVL1, DVL2 and/or DVL3). Modulates the developmental decision to build a columnar versus a hepatic epithelial cell apparently by promoting a switch from a direct to a transcytotic mode of apical protein delivery. Essential for the asymmetric development of membrane domains of polarized epithelial cells. {ECO:0000269|PubMed:11433294, ECO:0000269|PubMed:12429843, ECO:0000269|PubMed:14976552, ECO:0000269|PubMed:15158914, ECO:0000269|PubMed:15324659, ECO:0000269|PubMed:15365179, ECO:0000269|PubMed:16775013, ECO:0000269|PubMed:16980613, ECO:0000269|PubMed:18626018, ECO:0000269|PubMed:20194617, ECO:0000269|PubMed:23666762}. | FUNCTION: Essential component of the mitotic checkpoint. Required for normal mitosis progression. The mitotic checkpoint delays anaphase until all chromosomes are properly attached to the mitotic spindle. One of its checkpoint functions is to inhibit the activity of the anaphase-promoting complex/cyclosome (APC/C) by blocking the binding of CDC20 to APC/C, independently of its kinase activity. The other is to monitor kinetochore activities that depend on the kinetochore motor CENPE. Required for kinetochore localization of CENPE. Negatively regulates PLK1 activity in interphase cells and suppresses centrosome amplification. Also implicated in triggering apoptosis in polyploid cells that exit aberrantly from mitotic arrest. May play a role for tumor suppression. {ECO:0000269|PubMed:10477750, ECO:0000269|PubMed:11702782, ECO:0000269|PubMed:14706340, ECO:0000269|PubMed:15020684, ECO:0000269|PubMed:19411850, ECO:0000269|PubMed:19503101}. |
Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
- Retained domain in the 5'-partner of fusion protein (protein functional feature from UniProt). |
Partner | Hgeneene | Hbp | Tgeneene | Tbp | ENST | BPexon | TotalExon | Protein feature loci | BPloci | TotalLen | Feature | Note |
- Retained domain in the 3'-partner of fusion protein (protein functional feature from UniProt). |
Partner | Hgeneene | Hbp | Tgeneene | Tbp | ENST | BPexon | TotalExon | Protein feature loci | BPloci | TotalLen | Feature | Note |
Tgene | MARK2 | 63607032 | BUB1B | 40468677 | ENST00000377809 | 3 | 23 | 766_1050 | 128 | 1051 | Domain | Note=Protein kinase |
Tgene | MARK2 | 63607032 | BUB1B | 40468677 | ENST00000377809 | 3 | 23 | 766_1050 | 142 | 1065 | Domain | Note=Protein kinase |
Tgene | MARK2 | 63607032 | BUB1B | 40468678 | ENST00000377809 | 3 | 23 | 766_1050 | 128 | 1051 | Domain | Note=Protein kinase |
Tgene | MARK2 | 63607032 | BUB1B | 40468678 | ENST00000377809 | 3 | 23 | 766_1050 | 142 | 1065 | Domain | Note=Protein kinase |
Top |
Kinase Fusion Protein Structures |
CIF files of the predicted kinase fusion proteins * Here we show the 3D structure of the fusion proteins using Mol*. AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Model confidence is shown from the pLDDT values per residue. pLDDT corresponds to the model’s prediction of its score on the local Distance Difference Test. It is a measure of local accuracy (from AlphfaFold website). To color code individual residues, we transformed individual PDB files into CIF format. |
Kinase Fusion protein CIF link (fusion AA seq ID in KinaseFusionDB) | Henst | Tenst | Hgene | Hchr | Hbp | Tgene | Tchr | Tbp | AA seq | Len(AA seq) |
PDB file >>>299_MARK2_BUB1B | ENST00000377809 | ENST00000287598 | MARK2 | chr11 | 63607032 | BUB1B | chr15 | 40468677 | MSSARTPLPTLNERDTEQGRLCNEPLDMYSYLHNQGIGVSLAQFYISWAEEYEARENFRKADAIFQEGIQQKAEPLERLQSQHRQFQARV SRQTLLALEKEEEEEVFESSVPQRSTLAELKSKGKKTARAPIIRVGGALKAPSQNRGLQNPFPQQMQNNSRITVFDENADEASTAELSKP TVQPWIAPPMPRAKENELQAGPWNTGRSLEHRPRGNTASLIAVPAVLPSFTPYVEETARQPVMTPCKIEPSINHILSTRKPGKEEGDPLQ RVQSHQQASEEKKEKMMYCKEKIYAGVGEFSFEEIRAEVFRKKLKEQREAELLTSAEKRAEMQKQIEEMEKKLKEIQTTQQERTGDQQEE TMPTKETTKLQIASESQKIPGMTLSSSVCQVNCCARETSLAENIWQEQPHSKGPSVPFSIFDEFLLSEKKNKSPPADPPRVLAQRRPLAV LKTSESITSNEDVSPDVCDEFTGIEPLSEDAIITGFRNVTICPNPEDTCDFARAARFVSTPFHEIMSLKDLPSDPERLLPEEDLDVKTSE DQQTACGTIYSQTLSIKKLSPIIEDSREATHSSGFSGSSASVASTSSIKCLQIPEKLELTNETSENPTQSPWCSQYRRQLLKSLPELSAS AELCIEDRPMPKLEIEKEIELGNEDYCIKREYLICEDYKLFWVAPRNSAELTVIKVSSQPVPWDFYINLKLKERLNEDFDHFCSCYQYQD GCIVWHQYINCFTLQDLLQHSEYITHEITVLIIYNLLTIVEMLHKAEIVHGDLSPRCLILRNRIHDPYDCNKNNQALKIVDFSYSVDLRV QLDVFTLSGFRTVQILEGQKILANCSSPYQVDLFGIADLAHLLLFKEHLQVFWDGSFWKLSQNISELKDGELWNKFFVRILNANDEATVS | 940 |
3D view using mol* of 299_MARK2_BUB1B | ||||||||||
PDB file >>>TKFP_519_MARK2_BUB1B | ENST00000377809 | ENST00000287598 | MARK2 | chr11 | 63607032 | BUB1B | chr15 | 40468678 | MSSARTPLPTLNERDTEQGRLCNEPLDMYSYLHNQGIGVSLAQFYISWAEEYEARENFRKADAIFQEGIQQKAEPLERLQSQHRQFQARV SRQTLLALEKEEEEEVFESSVPQRSTLAELKSKGKKTARAPIIRVGGALKAPSQNRGLQNPFPQQMQNNSRITVFDENADEASTAELSKP TVQPWIAPPMPRAKENELQAGPWNTGRSLEHRPRGNTASLIAVPAVLPSFTPYVEETARQPVMTPCKIEPSINHILSTRKPGKEEGDPLQ RVQSHQQASEEKKEKMMYCKEKIYAGVGEFSFEEIRAEVFRKKLKEQREAELLTSAEKRAEMQKQIEEMEKKLKEIQTTQQERTGDQQEE TMPTKETTKLQIASESQKIPGMTLSSSVCQVNCCARETSLAENIWQEQPHSKGPSVPFSIFDEFLLSEKKNKSPPADPPRVLAQRRPLAV LKTSESITSNEDVSPDVCDEFTGIEPLSEDAIITGFRNVTICPNPEDTCDFARAARFVSTPFHEIMSLKDLPSDPERLLPEEDLDVKTSE DQQTACGTIYSQTLSIKKLSPIIEDSREATHSSGFSGSSASVASTSSIKCLQIPEKLELTNETSENPTQSPWCSQYRRQLLKSLPELSAS AELCIEDRPMPKLEIEKEIELGNEDYCIKREYLICEDYKLFWVAPRNSAELTVIKVSSQPVPWDFYINLKLKERLNEDFDHFCSCYQYQD GCIVWHQYINCFTLQDLLQHSEYITHEITVLIIYNLLTIVEMLHKAEIVHGDLSPRCLILRNRIHDPYDCNKNNQALKIVDFSYSVDLRV QLDVFTLSGFRTVQILEGQKILANCSSPYQVDLFGIADLAHLLLFKEHLQVFWDGSFWKLSQNISELKDGELWNKFFVRILNANDEATVS | 940_MARK2_BUB1B |
PDB file >>>TKFP_520_MARK2_BUB1B | ENST00000377809 | ENST00000287598 | MARK2 | chr11 | 63607032 | BUB1B | chr15 | 40468677 | MSSARTPLPTLNERDTEQGRLCNEPLDMYSYLHNQGIGVSLAQFYISWAEEYEARENFRKADAIFQEGIQQKAEPLERLQSQHRQFQARV SRQTLLALEKEEEEEVFESSVPQRSTLAELKSKGKKTARAPIIRVGGALKAPSQNRGLQNPFPQQMQNNSRITVFDENADEASTAELSKP TVQPWIAPPMPRAKENELQAGPWNTGRSLEHRPRGNTASLIAVPAVLPSFTPYVEETARQPVMTPCKIEPSINHILSTRKPGKEEGDPLQ RVQSHQQASEEKKEKMMYCKEKIYAGVGEFSFEEIRAEVFRKKLKEQREAELLTSAEKRAEMQKQIEEMEKKLKEIQTTQQERTGDQQEE TMPTKETTKLQIASESQKIPGMTLSSSVCQVNCCARETSLAENIWQEQPHSKGPSVPFSIFDEFLLSEKKNKSPPADPPRVLAQRRPLAV LKTSESITSNEDVSPDVCDEFTGIEPLSEDAIITGFRNVTICPNPEDTCDFARAARFVSTPFHEIMSLKDLPSDPERLLPEEDLDVKTSE DQQTACGTIYSQTLSIKKLSPIIEDSREATHSSGFSGSSASVASTSSIKCLQIPEKLELTNETSENPTQSPWCSQYRRQLLKSLPELSAS AELCIEDRPMPKLEIEKEIELGNEDYCIKREYLICEDYKLFWVAPRNSAELTVIKVSSQPVPWDFYINLKLKERLNEDFDHFCSCYQYQD GCIVWHQYINCFTLQDLLQHSEYITHEITVLIIYNLLTIVEMLHKAEIVHGDLSPRCLILRNRIHDPYDCNKNNQALKIVDFSYSVDLRV QLDVFTLSGFRTVQILEGQKILANCSSPYQVDLFGIADLAHLLLFKEHLQVFWDGSFWKLSQNISELKDGELWNKFFVRILNANDEATVS | 940_MARK2_BUB1B |
Top |
Comparison of Fusion Protein Isoforms |
Superimpose the 3D Structures Among All Fusion Protein Isoforms * Download the pdb file and open it from the molstar online viewer. |
Comparison of the Secondary Structures of Fusion Protein Isoforms |
Top |
Comparison of Fusion Protein Sequences/Structures with Known Sequences/Structures from PDB |
Top |
pLDDT score distribution |
pLDDT score distribution of the predicted fusion protein structures from AlphaFold2 * AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. * The blue color at the bottom marks the best active site residues. |
299_MARK2_BUB1B.png |
299_MARK2_BUB1B.png |
Top |
Potential Active Site Information |
The potential binding sites of these fusion proteins were identified using SiteMap, a module of the Schrodinger suite. |
Kinase Fusion AA seq ID in KinaseFusionDB | Site score | Size | Dscore | Volume | Exposure | Enclosure | Contact | Phobic | Philic | Balance | Don/Acc | Residues |
Top |
Ramachandran Plot of Kinase Fusion Protein Structure |
Ramachandran plot of the torsional angles - phi (φ)and psi (ψ) - of the residues (amino acids) contained in this fusion protein peptide. |
299_MARK2_BUB1B_ramachandran.png |
Top |
Virtual Screening Results |
Distribution of the average docking score across all approved kinase inhibitors. Distribution of the number of occurrence across all approved kinase inhibitors. |
5'-kinase fusion protein case |
3'-kinase fusion protein case |
Top |
Drug information from DrugBank of the top 20 interacting small molecules. * The detailed information of individual kinase inhibitors are available in the download page. |
Fusion gene name info | Drug | Docking score | Glide g score | Glide energy |
Top |
Kinase-Substrate Information of MARK2_BUB1B |
Phosphorylation target of the kinase (phosphosite, 03-17-2024) |
Kinase | Kinase UniProt Acc | Kinase species | Substrate | Substrate UniProt Acc | Substrate phosphorylated residues | Substrate phosphorylated sites (+/-7AA) | Domain |
MARK2 | Q7KZI7 | human | KIF13B | Q9NQT8 | S1410 | SNKGRWEsQQDVsQT | |
MARK2 | Q7KZI7 | human | ARHGEF2 | Q92974 | S186 | NMRNRtLsVEsLIDE | |
MARK2 | Q7KZI7 | human | RAB11FIP2 | Q7L804 | S227 | QRLsSAHsMsDLSGS | |
MARK2 | Q7KZI7 | human | MAPT | P10636-8 | S262 | NVKskIGstENLkHQ | Tubulin-binding |
MARK2 | Q7KZI7 | human | HDAC4 | P56524 | S467 | RPLGRtQsAPLPQNA | |
MARK2 | Q7KZI7 | human | MAPT | P10636-8 | S324 | kVTskCGsLGNIHHk | Tubulin-binding |
MARK2 | Q7KZI7 | human | DLG4 | P78352 | S561 | EFPDKFGsCVPHTTR | Guanylate_kin |
MARK2 | Q7KZI7 | human | STK3 | Q13188 | S15 | KSKLKkLsEDsLTkQ | |
MARK2 | Q7KZI7 | human | ARHGEF2 | Q92974-2 | S885 | PVDPRRRsLPAGDAL | |
MARK2 | Q7KZI7 | human | PINK1 | Q9BXM7 | T313 | EGLGHGRtLFLVMkN | Pkinase |
MARK2 | Q7KZI7 | human | UTRN | P46939 | S1258 | TLEERMKsTEVLPEk | |
MARK2 | Q7KZI7 | human | ARHGEF2 | Q92974 | S143 | GsRRGRssLsLAksV | |
MARK2 | Q7KZI7 | human | RAB11FIP1 | Q6WKZ4-3 | S234 | QKTPLSQsMSVLPTS | |
MARK2 | Q7KZI7 | human | HDAC7 | Q8WUI4 | S155 | FPLRKtVsEPNLkLR | |
MARK2 | Q7KZI7 | human | HDAC4 | P56524 | S246 | FPLRkTAsEPNLKLR | |
MARK2 | Q7KZI7 | human | PARD3 | Q8TEW0 | S873 | VDDQKAGsPsRDVGP | |
MARK2 | Q7KZI7 | human | MARK2 | Q7KZI7 | S400 | HkVQRsVsANPKQRR | |
MARK2 | Q7KZI7 | human | PTK2 | Q05397 | Y397 | sVsEtDDyAEIIDEE | |
MARK2 | Q7KZI7 | human | ARHGEF2 | Q92974-2 | S959 | SRLSPPHsPRDFTRM | |
MARK2 | Q7KZI7 | human | MAPT | P10636-8 | S356 | rVQskIGsLDNItHV | Tubulin-binding |
MARK2 | Q7KZI7 | human | FEZ1 | Q99689 | S58 | SEIISFKsMEDLVNE | FEZ |
MARK2 | Q7KZI7 | human | RNF41 | Q9H4P4 | S254 | IENAHERsWPQGLAT | USP8_interact |
MARK2 | Q7KZI7 | human | MYL9 | P24844 | S20 | KRPQRAtsNVFAMFD | |
MARK2 | Q7KZI7 | human | BAIAP2 | Q9UQB8 | S366 | ktLPRsssMAAGLER | |
MARK2 | Q7KZI7 | human | ARHGEF2 | Q92974 | S172 | LGLRRILsQstDsLN | |
MARK2 | Q7KZI7 | human | HDAC5 | Q9UQL6 | S259 | FPLRkTAsEPNLKVR | |
MARK2 | Q7KZI7 | human | PARD3 | Q8TEW0 | S144 | PLHVRRssDPALIGL | |
MARK2 | Q7KZI7 | human | EIF2S1 | P05198 | S52 | MILLsELsRRRIRsI | S1 |
MARK2 | Q7KZI7 | human | KIF13B | Q9NQT8 | S1381 | KLSRRsIssPNVNRL |
Biological Network Integration of This Kinase and Substrates (GeneMANIA website) |
Enriched GO biological processes of the phosphorylation target genes of the kinase |
Kinase | GOID | GO term | P.adjust |
MARK2 | ID | Description | 0.00e+00 |
MARK2 | GO:0007163 | establishment or maintenance of cell polarity | 9.52e-05 |
MARK2 | GO:0007409 | axonogenesis | 1.17e-04 |
MARK2 | GO:0030010 | establishment of cell polarity | 1.64e-04 |
MARK2 | GO:0016242 | negative regulation of macroautophagy | 1.20e-03 |
MARK2 | GO:0043393 | regulation of protein binding | 2.17e-03 |
MARK2 | GO:0051646 | mitochondrion localization | 2.17e-03 |
MARK2 | GO:0010823 | negative regulation of mitochondrion organization | 2.17e-03 |
MARK2 | GO:0033674 | positive regulation of kinase activity | 2.17e-03 |
MARK2 | GO:0045197 | establishment or maintenance of epithelial cell apical/basal polarity | 2.17e-03 |
MARK2 | GO:0031346 | positive regulation of cell projection organization | 2.17e-03 |
MARK2 | GO:0035088 | establishment or maintenance of apical/basal cell polarity | 2.17e-03 |
MARK2 | GO:0061245 | establishment or maintenance of bipolar cell polarity | 2.17e-03 |
MARK2 | GO:0006476 | protein deacetylation | 2.17e-03 |
MARK2 | GO:0010639 | negative regulation of organelle organization | 2.17e-03 |
MARK2 | GO:0035601 | protein deacylation | 3.02e-03 |
MARK2 | GO:0098732 | macromolecule deacylation | 3.23e-03 |
MARK2 | GO:0051347 | positive regulation of transferase activity | 3.35e-03 |
MARK2 | GO:0035418 | protein localization to synapse | 3.97e-03 |
MARK2 | GO:1902902 | negative regulation of autophagosome assembly | 4.22e-03 |
MARK2 | GO:0010975 | regulation of neuron projection development | 4.36e-03 |
MARK2 | GO:0051091 | positive regulation of DNA-binding transcription factor activity | 4.48e-03 |
MARK2 | GO:0010507 | negative regulation of autophagy | 4.48e-03 |
MARK2 | GO:0032273 | positive regulation of protein polymerization | 4.48e-03 |
MARK2 | GO:0022604 | regulation of cell morphogenesis | 4.48e-03 |
MARK2 | GO:0051896 | regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction | 4.48e-03 |
MARK2 | GO:0010832 | negative regulation of myotube differentiation | 4.48e-03 |
MARK2 | GO:1901524 | regulation of mitophagy | 4.48e-03 |
MARK2 | GO:0061912 | selective autophagy | 4.48e-03 |
MARK2 | GO:0032886 | regulation of microtubule-based process | 4.48e-03 |
MARK2 | GO:0000422 | autophagy of mitochondrion | 4.48e-03 |
MARK2 | GO:0061726 | mitochondrion disassembly | 4.48e-03 |
MARK2 | GO:0051098 | regulation of binding | 4.48e-03 |
MARK2 | GO:0019896 | axonal transport of mitochondrion | 4.76e-03 |
MARK2 | GO:0008356 | asymmetric cell division | 5.16e-03 |
MARK2 | GO:1902414 | protein localization to cell junction | 5.28e-03 |
MARK2 | GO:0045860 | positive regulation of protein kinase activity | 5.28e-03 |
MARK2 | GO:0043491 | phosphatidylinositol 3-kinase/protein kinase B signal transduction | 5.72e-03 |
MARK2 | GO:0031644 | regulation of nervous system process | 6.59e-03 |
MARK2 | GO:0062197 | cellular response to chemical stress | 7.62e-03 |
MARK2 | GO:0034643 | establishment of mitochondrion localizatio | 3.42e-04 |
MARK2 | GO:0016236 | macroautophagy | 8.34e-03 |
MARK2 | GO:0008360 | regulation of cell shape | 9.38e-03 |
MARK2 | GO:0009895 | negative regulation of catabolic process | 9.46e-03 |
MARK2 | GO:0051654 | establishment of mitochondrion localization | 9.46e-03 |
MARK2 | GO:0090140 | regulation of mitochondrial fission | 9.46e-03 |
MARK2 | GO:1903008 | organelle disassembly | 9.46e-03 |
MARK2 | GO:0010506 | regulation of autophagy | 9.46e-03 |
MARK2 | GO:2000377 | regulation of reactive oxygen species metabolic process | 9.46e-03 |
MARK2 | GO:0034063 | stress granule assembly | 9.46e-03 |
Top |
Related Drugs to MARK2_BUB1B |
Drugs used for this fusion-positive patient. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Drug | Source | PMID |
Distribution of the number of studies mentioning MARK2-BUB1B and kinase inhibitors the PubMed Abstract (04-01-2024) |
Fusion gene - drug pair 1 | Fusion gene - drug pair 2 | PMID | Publication date | DOI | Study title |
Top |
Related Diseases to MARK2_BUB1B |
Diseases that have this fusion gene. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Disease | Source | PMID |
Related diseases from the literature mentioned this fusion gene and drug. (PubMed, 04-01-2024) |
MeSH ID | MeSH term |
Diseases associated with fusion partners. (DisGeNet 4.0) |
Partner | Gene | Disease ID | Disease name | # pubmeds | Source |
Top |
Clinical Trials of the Found Drugs/Small Molecules |
Statistics of the Clinical Trials of the Found Kinase Inibitors from clinicaltrials.gov (06-17-2024) |
Clinical Trials from clinicaltrials.gov (06-17-2024) |
Fusion Gene | Kinase Inhibitor | NCT ID | Study Status | Phases | Disease | # Enrolment | Date |