UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
|
Kinase Fusion Gene:MELK_P4HA1 |
Kinase Fusion Protein Summary |
Kinase Fusion gene summary |
Kinase Fusion partner gene information | Kinase Fusion gene name: MELK_P4HA1 | KinaseFusionDB ID: KFG3786 | FusionGDB2.0 ID: KFG3786 | Hgene | Tgene | Gene symbol | MELK | P4HA1 | Gene ID | 9833 | 5033 | |
Gene name | maternal embryonic leucine zipper kinase | prolyl 4-hydroxylase subunit alpha 1 | ||||||||||
Synonyms | HPK38 | P4HA | ||||||||||
Cytomap | 9p13.2 | 10q22.1 | ||||||||||
Type of gene | protein-coding | protein-coding | ||||||||||
Description | maternal embryonic leucine zipper kinasepEg3 kinaseprotein kinase Eg3protein kinase PK38tyrosine-protein kinase MELK | prolyl 4-hydroxylase subunit alpha-1C-P4Halpha(I)collagen prolyl 4-hydroxylase alpha(I)procollagen-proline, 2-oxoglutarate 4-dioxygenase (proline 4-hydroxylase), alpha polypeptide Iprocollagen-proline,2-oxoglutarate-4-dioxygenase subunit alpha-1proly | ||||||||||
Modification date | 20240403 | 20240407 | ||||||||||
UniProtAcc | Q14680 | P13674 | ||||||||||
Ensembl transtripts involved in fusion gene | ENST ids | ENST00000298048, ENST00000538311, ENST00000536987, ENST00000536860, ENST00000545008, ENST00000536329, ENST00000541717, ENST00000543751, ENST00000487398, | ENST00000307116, ENST00000373008, ENST00000263556, ENST00000412021, ENST00000440381, ENST00000394890, | |||||||||
Context (manual curation of fusion genes in KinaseFusionDB) | PubMed: MELK [Title/Abstract] AND P4HA1 [Title/Abstract] AND fusion [Title/Abstract] | |||||||||||
Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) |
Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
Partner | Gene | GO ID | GO term | PubMed ID |
Hgene | MELK | GO:0006915 | apoptotic process | 17280616 |
Hgene | MELK | GO:0008283 | cell population proliferation | 17280616 |
Hgene | MELK | GO:0046777 | protein autophosphorylation | 16216881 |
Kinase Fusion gene breakpoints across MELK (5'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Kinase Fusion gene breakpoints across P4HA1 (3'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Top |
Kinase Fusion Gene Sample Information |
Kinase Fusion gene information. |
Kinase Fusion gene information from four resources (ChiTars 5.0, ChimerDB 4.0, COSMIC, and CCLE) * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
Source | Sample | Hgene | Hchr | Hbp | Tgene | Tchr | Tbp |
CCLE | SK-N-BE(2) | MELK | chr9 | 36651874 | P4HA1 | chr10 | 74774047 |
Top |
Kinase Fusion ORF Analysis |
Kinase Fusion information from ORFfinder translation from full-length transcript sequence from KinaseFusionDB. |
Henst | Tenst | Hgene | Hchr | Hbp | Tgene | Tchr | Tbp | Seq length (transcript) | Seq length (amino acids) |
ENST00000298048 | ENST00000307116 | MELK | chr9 | 36651874 | P4HA1 | chr10 | 74774047 | 2545 | 451 |
Top |
Kinase Fusion Amino Acid Sequences |
For individual full-length fusion transcript sequence from KinaseFusionDB, we ran ORFfinder and chose the longest ORF among the all predicted ones. |
>Henst_Tenst_Hgene_Hchr_Hbp_Tgene_Tchr_Tbp_length(fusion AA)_AAseq >ENST00000298048_ENST00000307116_MELK_chr9_36651874_P4HA1_chr10_74774047_length(amino acids)=451 MKDYDELLKYYELHETIGTGGFAKVKLACHILTGEMVAIKIMDKNTLGSDLPRIKTEIEALKNLRHQHICQLYHVLETANKIFMVLEYCP GGELFDYIISQDRLSEEETRVVFRQIVSAVAYVHSQGYAHRDLKPENLLFDEYHKLKLIDFGLCAKPKGNKDYHLQTCCGSLAYAAPELI QGKSYLGSEADVWSMGILLYVLMCGFLPFDDDNVMALYKKIMRGKYDVPKWLSPSSILLLQQMLQVDPKKRISMKNLLNHPWIMQDYNYP VEWQSKNPFIHLDDDCVTELSVHHRNNRQTMEDLISLWQYDHLTATYLLLLAKKARGKPVRLRLSSFSCGQASATPFTDIKKDEPDAFKE LGTGNRIATWLFYMSDVSAGGATVFPEVGASVWPKKGTAVFWYNLFASGEGDYSTRHAACPVLVGNKWVSNKWLHERGQEFRRPCTLSEL -------------------------------------------------------------- |
Multiple Sequence Alignment of All Fusion Protein Isoforms |
Top |
Kinase Fusion Protein Functional Features |
Four levels of functional features of fusion genes Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr9:/chr10:) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
Main function of each fusion partner protein. (from UniProt) |
Hgene | Tgene |
MELK | P4HA1 |
FUNCTION: Serine/threonine-protein kinase involved in various processes such as cell cycle regulation, self-renewal of stem cells, apoptosis and splicing regulation. Has a broad substrate specificity; phosphorylates BCL2L14, CDC25B, MAP3K5/ASK1 and ZNF622. Acts as an activator of apoptosis by phosphorylating and activating MAP3K5/ASK1. Acts as a regulator of cell cycle, notably by mediating phosphorylation of CDC25B, promoting localization of CDC25B to the centrosome and the spindle poles during mitosis. Plays a key role in cell proliferation and carcinogenesis. Required for proliferation of embryonic and postnatal multipotent neural progenitors. Phosphorylates and inhibits BCL2L14, possibly leading to affect mammary carcinogenesis by mediating inhibition of the pro-apoptotic function of BCL2L14. Also involved in the inhibition of spliceosome assembly during mitosis by phosphorylating ZNF622, thereby contributing to its redirection to the nucleus. May also play a role in primitive hematopoiesis. {ECO:0000269|PubMed:11802789, ECO:0000269|PubMed:12400006, ECO:0000269|PubMed:14699119, ECO:0000269|PubMed:15908796, ECO:0000269|PubMed:16216881, ECO:0000269|PubMed:17280616}. | FUNCTION: Catalyzes the post-translational formation of 4-hydroxyproline in -Xaa-Pro-Gly- sequences in collagens and other proteins. {ECO:0000269|PubMed:9211872}. |
Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
- Retained domain in the 5'-partner of fusion protein (protein functional feature from UniProt). |
Partner | Hgeneene | Hbp | Tgeneene | Tbp | ENST | BPexon | TotalExon | Protein feature loci | BPloci | TotalLen | Feature | Note |
Hgene | MELK | 36651874 | P4HA1 | 74774047 | ENST00000298048 | 10 | 16 | 11_263 | 2801 | 581 | Domain | Note=Protein kinase;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00159 |
Hgene | MELK | 36651874 | P4HA1 | 74774047 | ENST00000298048 | 11 | 17 | 11_263 | 3031 | 604 | Domain | Note=Protein kinase;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00159 |
Hgene | MELK | 36651874 | P4HA1 | 74774047 | ENST00000298048 | 11 | 17 | 11_263 | 3191 | 620 | Domain | Note=Protein kinase;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00159 |
Hgene | MELK | 36651874 | P4HA1 | 74774047 | ENST00000298048 | 12 | 17 | 11_263 | 3511 | 611 | Domain | Note=Protein kinase;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00159 |
Hgene | MELK | 36651874 | P4HA1 | 74774047 | ENST00000298048 | 12 | 18 | 11_263 | 3511 | 652 | Domain | Note=Protein kinase;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00159 |
- Retained domain in the 3'-partner of fusion protein (protein functional feature from UniProt). |
Partner | Hgeneene | Hbp | Tgeneene | Tbp | ENST | BPexon | TotalExon | Protein feature loci | BPloci | TotalLen | Feature | Note |
Top |
Kinase Fusion Protein Structures |
CIF files of the predicted kinase fusion proteins * Here we show the 3D structure of the fusion proteins using Mol*. AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Model confidence is shown from the pLDDT values per residue. pLDDT corresponds to the model’s prediction of its score on the local Distance Difference Test. It is a measure of local accuracy (from AlphfaFold website). To color code individual residues, we transformed individual PDB files into CIF format. |
Kinase Fusion protein CIF link (fusion AA seq ID in KinaseFusionDB) | Henst | Tenst | Hgene | Hchr | Hbp | Tgene | Tchr | Tbp | AA seq | Len(AA seq) |
PDB file >>>HKFP_240_MELK_P4HA1 | ENST00000298048 | ENST00000307116 | MELK | chr9 | 36651874 | P4HA1 | chr10 | 74774047 | MKDYDELLKYYELHETIGTGGFAKVKLACHILTGEMVAIKIMDKNTLGSDLPRIKTEIEALKNLRHQHICQLYHVLETANKIFMVLEYCP GGELFDYIISQDRLSEEETRVVFRQIVSAVAYVHSQGYAHRDLKPENLLFDEYHKLKLIDFGLCAKPKGNKDYHLQTCCGSLAYAAPELI QGKSYLGSEADVWSMGILLYVLMCGFLPFDDDNVMALYKKIMRGKYDVPKWLSPSSILLLQQMLQVDPKKRISMKNLLNHPWIMQDYNYP VEWQSKNPFIHLDDDCVTELSVHHRNNRQTMEDLISLWQYDHLTATYLLLLAKKARGKPVRLRLSSFSCGQASATPFTDIKKDEPDAFKE LGTGNRIATWLFYMSDVSAGGATVFPEVGASVWPKKGTAVFWYNLFASGEGDYSTRHAACPVLVGNKWVSNKWLHERGQEFRRPCTLSEL | 451_MELK_P4HA1 |
3D view using mol* of HKFP_240_MELK_P4HA1 | ||||||||||
Top |
Comparison of Fusion Protein Isoforms |
Superimpose the 3D Structures Among All Fusion Protein Isoforms * Download the pdb file and open it from the molstar online viewer. |
Comparison of the Secondary Structures of Fusion Protein Isoforms |
Top |
Comparison of Fusion Protein Sequences/Structures with Known Sequences/Structures from PDB |
Top |
pLDDT score distribution |
pLDDT score distribution of the predicted fusion protein structures from AlphaFold2 * AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. * The blue color at the bottom marks the best active site residues. |
Top |
Potential Active Site Information |
The potential binding sites of these fusion proteins were identified using SiteMap, a module of the Schrodinger suite. |
Kinase Fusion AA seq ID in KinaseFusionDB | Site score | Size | Dscore | Volume | Exposure | Enclosure | Contact | Phobic | Philic | Balance | Don/Acc | Residues |
Top |
Ramachandran Plot of Kinase Fusion Protein Structure |
Ramachandran plot of the torsional angles - phi (φ)and psi (ψ) - of the residues (amino acids) contained in this fusion protein peptide. |
HKFP_240_MELK_P4HA1_ramachandran.png |
Top |
Virtual Screening Results |
Distribution of the average docking score across all approved kinase inhibitors. Distribution of the number of occurrence across all approved kinase inhibitors. |
5'-kinase fusion protein case |
3'-kinase fusion protein case |
Top |
Drug information from DrugBank of the top 20 interacting small molecules. * The detailed information of individual kinase inhibitors are available in the download page. |
Fusion gene name info | Drug | Docking score | Glide g score | Glide energy |
HKFP_240_MELK_P4HA1-outDOCK_HTVS_1-001 | Midostaurin | -8.615219999999999 | -8.615219999999999 | -56.5718 |
HKFP_240_MELK_P4HA1-outDOCK_HTVS_1-001 | Midostaurin | -8.40156 | -8.40156 | -56.426 |
HKFP_240_MELK_P4HA1-outDOCK_HTVS_1-001 | Dacomitinib | -8.3753 | -8.4836 | -56.7699 |
HKFP_240_MELK_P4HA1-outDOCK_HTVS_1-001 | Dacomitinib | -8.3753 | -8.4836 | -56.7699 |
HKFP_240_MELK_P4HA1-outDOCK_HTVS_1-001 | Midostaurin | -8.35551 | -8.35551 | -56.5287 |
HKFP_240_MELK_P4HA1-outDOCK_HTVS_1-001 | Dacomitinib | -8.348130000000001 | -8.457130000000001 | -56.7018 |
HKFP_240_MELK_P4HA1-outDOCK_HTVS_1-001 | Baricitinib | -7.73176 | -7.73176 | -46.3718 |
HKFP_240_MELK_P4HA1-outDOCK_HTVS_1-001 | Tofacitinib | -7.35635 | -7.36785 | -41.9761 |
HKFP_240_MELK_P4HA1-outDOCK_HTVS_1-001 | Tofacitinib | -7.35635 | -7.36785 | -41.9761 |
HKFP_240_MELK_P4HA1-outDOCK_HTVS_1-001 | Vandetanib | -7.32255 | -7.32255 | -43.3239 |
HKFP_240_MELK_P4HA1-outDOCK_HTVS_1-001 | Crizotinib | -7.1966600000000005 | -7.69256 | -45.54 |
HKFP_240_MELK_P4HA1-outDOCK_HTVS_1-001 | Crizotinib | -7.1966600000000005 | -7.69256 | -45.54 |
HKFP_240_MELK_P4HA1-outDOCK_HTVS_1-001 | Afatinib | -7.1807 | -7.362999999999999 | -56.5045 |
HKFP_240_MELK_P4HA1-outDOCK_HTVS_1-001 | Afatinib | -7.1807 | -7.362999999999999 | -56.5045 |
HKFP_240_MELK_P4HA1-outDOCK_HTVS_1-001 | Afatinib | -7.1793 | -7.362999999999999 | -56.5045 |
HKFP_240_MELK_P4HA1-outDOCK_HTVS_1-001 | Afatinib | -7.1337 | -7.316 | -52.5442 |
HKFP_240_MELK_P4HA1-outDOCK_HTVS_1-001 | Afatinib | -7.1337 | -7.316 | -52.5442 |
HKFP_240_MELK_P4HA1-outDOCK_HTVS_1-001 | Afatinib | -7.1323 | -7.316 | -52.5442 |
HKFP_240_MELK_P4HA1-outDOCK_HTVS_1-001 | Upadacitinib | -7.0938300000000005 | -7.09483 | -41.6824 |
HKFP_240_MELK_P4HA1-outDOCK_HTVS_1-001 | Dacomitinib | -7.04472 | -7.15302 | -54.5406 |
320_MELK_P4HA1-DOCK_HTVS_1-001 | Mobocertinib | -7.59496 | -7.60266 | -57.5396 |
320_MELK_P4HA1-DOCK_HTVS_1-001 | Sunitinib | -6.6605300000000005 | -6.6647300000000005 | -34.9952 |
320_MELK_P4HA1-DOCK_HTVS_1-001 | Pralsetinib | -6.556660000000001 | -6.648160000000001 | -59.5284 |
320_MELK_P4HA1-DOCK_HTVS_1-001 | Pralsetinib | -6.41608 | -6.50758 | -59.221000000000004 |
320_MELK_P4HA1-DOCK_HTVS_1-001 | Tofacitinib | -6.201219999999999 | -6.21272 | -34.2598 |
320_MELK_P4HA1-DOCK_HTVS_1-001 | Tofacitinib | -6.201219999999999 | -6.21272 | -34.2598 |
320_MELK_P4HA1-DOCK_HTVS_1-001 | Nilotinib | -6.05176 | -6.1913599999999995 | -48.5272 |
320_MELK_P4HA1-DOCK_HTVS_1-001 | Nilotinib | -6.05176 | -6.1913599999999995 | -48.5272 |
320_MELK_P4HA1-DOCK_HTVS_1-001 | Sorafenib | -5.89002 | -5.90212 | -45.1663 |
320_MELK_P4HA1-DOCK_HTVS_1-001 | Sorafenib | -5.89002 | -5.90212 | -45.1663 |
320_MELK_P4HA1-DOCK_HTVS_1-001 | Tivozanib | -5.87314 | -5.87314 | -30.0772 |
320_MELK_P4HA1-DOCK_HTVS_1-001 | Pexidartinib | -5.74216 | -5.95896 | -37.7089 |
320_MELK_P4HA1-DOCK_HTVS_1-001 | Pexidartinib | -5.74216 | -5.95896 | -37.7089 |
320_MELK_P4HA1-DOCK_HTVS_1-001 | Ibrutinib | -5.66456 | -5.66456 | -47.7479 |
320_MELK_P4HA1-DOCK_HTVS_1-001 | Pralsetinib | -5.59635 | -6.74855 | -60.0102 |
320_MELK_P4HA1-DOCK_HTVS_1-001 | Selpercatinib | -5.47755 | -5.50805 | -46.0508 |
320_MELK_P4HA1-DOCK_HTVS_1-001 | Lapatinib | -5.40991 | -5.49871 | -35.8224 |
320_MELK_P4HA1-DOCK_HTVS_1-001 | Neratinib | -5.2725599999999995 | -5.45846 | -42.0899 |
320_MELK_P4HA1-DOCK_HTVS_1-001 | Tofacitinib | -5.22624 | -5.2377400000000005 | -26.1374 |
320_MELK_P4HA1-DOCK_HTVS_1-001 | Tofacitinib | -5.22624 | -5.2377400000000005 | -26.1374 |
Top |
Kinase-Substrate Information of MELK_P4HA1 |
Phosphorylation target of the kinase (phosphosite, 03-17-2024) |
Kinase | Kinase UniProt Acc | Kinase species | Substrate | Substrate UniProt Acc | Substrate phosphorylated residues | Substrate phosphorylated sites (+/-7AA) | Domain |
MELK | Q14680 | human | CDC25B | P30305 | S169 | VLRNItNsQAPDGRR | M-inducer_phosp |
MELK | Q14680 | human | MELK | Q14680 | T539 | RGLDkVItVLtRsKR | |
MELK | Q14680 | human | MELK | Q14680 | T387 | DLSTGAAtPRTsQFT | |
MELK | Q14680 | human | MELK | Q14680 | T494 | TGtDkLMtGVIsPER | |
MELK | Q14680 | human | MELK | Q14680 | S431 | ENVytPKsAVkNEEy | |
MELK | Q14680 | human | MELK | Q14680 | T398 | sQFTkYWtEsNGVEs | |
MELK | Q14680 | human | MELK | Q14680 | T167 | NkDyHLQtCCGsLAY | Pkinase |
MELK | Q14680 | human | MELK | Q14680 | S171 | HLQtCCGsLAYAAPE | Pkinase |
MELK | Q14680 | human | CDC25B | P30305 | S323 | QRLFRsPsMPCsVIR | M-inducer_phosp |
MELK | Q14680 | human | MELK | Q14680 | S405 | tEsNGVEsksLtPAL | |
MELK | Q14680 | human | MELK | Q14680 | T409 | GVEsksLtPALCRtP | |
MELK | Q14680 | human | MELK | Q14680 | S356 | DIKSNNWsLEDVTAs | |
MELK | Q14680 | human | MELK | Q14680 | Y438 | sAVkNEEyFMFPEPK | |
MELK | Q14680 | human | MELK | Q14680 | S529 | KGAkVFGsLERGLDk | |
MELK | Q14680 | human | MELK | Q14680 | Y367 | VTAsDKNyVAGLIDY | |
MELK | Q14680 | human | EIF4B | P23588 | S406 | RPRERHPsWRsEEtQ | |
MELK | Q14680 | human | EZH2 | Q15910 | S220 | RPPRKFPsDKIFEAI | PRC2_HTH_1 |
MELK | Q14680 | human | MELK | Q14680 | S505 | sPERRCRsVELDLNQ | |
MELK | Q14680 | human | MELK | Q14680 | S407 | sNGVEsksLtPALCR | |
MELK | Q14680 | human | MELK | Q14680 | S336 | PVRLRLssFsCGQAs | |
MELK | Q14680 | human | MELK | Q14680 | S343 | sFsCGQAsAtPFtDI | |
MELK | Q14680 | human | MELK | Q14680 | S391 | GAAtPRTsQFTkYWt | |
MELK | Q14680 | human | EIF4B | P23588 | S422 | RERsRtGsEssQtGt | |
MELK | Q14680 | human | MELK | Q14680 | Y163 | kPKGNkDyHLQtCCG | Pkinase |
MELK | Q14680 | human | MELK | Q14680 | S253 | VDPKKRIsMkNLLNH | Pkinase |
MELK | Q14680 | human | MELK | Q14680 | T56 | sDLPRIktEIEALkN | Pkinase |
Biological Network Integration of This Kinase and Substrates (GeneMANIA website) |
Enriched GO biological processes of the phosphorylation target genes of the kinase |
Kinase | GOID | GO term | P.adjust |
MELK | ID | Description | 0.00e+00 |
MELK | GO:0044772 | mitotic cell cycle phase transition | 1.12e-02 |
MELK | GO:1901989 | positive regulation of cell cycle phase transition | 1.84e-02 |
MELK | GO:0000086 | G2/M transition of mitotic cell cycle | 1.84e-02 |
MELK | GO:0044839 | cell cycle G2/M phase transition | 1.84e-02 |
MELK | GO:0090068 | positive regulation of cell cycle process | 3.69e-02 |
MELK | GO:0045787 | positive regulation of cell cycle | 3.69e-02 |
MELK | GO:1901990 | regulation of mitotic cell cycle phase transition | 3.69e-02 |
MELK | GO:1901993 | regulation of meiotic cell cycle phase transition | 3.69e-02 |
MELK | GO:0071236 | cellular response to antibiotic | 3.69e-02 |
MELK | GO:0007144 | female meiosis I | 3.69e-02 |
MELK | GO:0044771 | meiotic cell cycle phase transition | 3.69e-02 |
MELK | GO:0140719 | constitutive heterochromatin formation | 3.69e-02 |
MELK | GO:0045605 | negative regulation of epidermal cell differentiation | 3.69e-02 |
MELK | GO:0045683 | negative regulation of epidermis development | 3.69e-02 |
MELK | GO:1901987 | regulation of cell cycle phase transition | 3.69e-02 |
MELK | GO:0048385 | regulation of retinoic acid receptor signaling pathway | 3.69e-02 |
MELK | GO:1900006 | positive regulation of dendrite development | 3.69e-02 |
MELK | GO:0070314 | G1 to G0 transition | 4.12e-02 |
MELK | GO:0034244 | negative regulation of transcription elongation by RNA polymerase II | 4.12e-02 |
MELK | GO:0032785 | negative regulation of DNA-templated transcriptio | 4.87e-03 |
MELK | GO:0051446 | positive regulation of meiotic cell cycle | 4.29e-02 |
MELK | GO:0010971 | positive regulation of G2/M transition of mitotic cell cycle | 4.29e-02 |
MELK | GO:0097421 | liver regeneration | 4.29e-02 |
MELK | GO:0003299 | muscle hypertrophy in response to stress | 4.29e-02 |
MELK | GO:0014887 | cardiac muscle adaptation | 4.29e-02 |
MELK | GO:0014898 | cardiac muscle hypertrophy in response to stress | 4.29e-02 |
MELK | GO:0048384 | retinoic acid receptor signaling pathway | 4.29e-02 |
MELK | GO:1902751 | positive regulation of cell cycle G2/M phase transition | 4.29e-02 |
MELK | GO:0001556 | oocyte maturation | 4.29e-02 |
MELK | GO:0090183 | regulation of kidney development | 4.29e-02 |
MELK | GO:0046677 | response to antibiotic | 4.33e-02 |
MELK | GO:0007143 | female meiotic nuclear division | 4.33e-02 |
MELK | GO:0043403 | skeletal muscle tissue regeneration | 4.33e-02 |
MELK | GO:0045616 | regulation of keratinocyte differentiation | 4.33e-02 |
MELK | GO:0051154 | negative regulation of striated muscle cell differentiation | 4.33e-02 |
MELK | GO:1900016 | negative regulation of cytokine production involved in inflammatory response | 4.33e-02 |
MELK | GO:0140718 | facultative heterochromatin formation | 4.67e-02 |
MELK | GO:0032467 | positive regulation of cytokinesis | 4.67e-02 |
MELK | GO:0006305 | DNA alkylation | 4.67e-02 |
MELK | GO:0006306 | DNA methylation | 4.67e-02 |
MELK | GO:0021695 | cerebellar cortex development | 4.67e-02 |
MELK | GO:0014888 | striated muscle adaptation | 4.67e-02 |
MELK | GO:0030857 | negative regulation of epithelial cell differentiation | 4.67e-02 |
MELK | GO:0051932 | synaptic transmissio | 1.22e-02 |
MELK | GO:0071168 | protein localization to chromatin | 4.67e-02 |
MELK | GO:0045604 | regulation of epidermal cell differentiation | 4.67e-02 |
MELK | GO:0048599 | oocyte development | 4.67e-02 |
MELK | GO:0008631 | intrinsic apoptotic signaling pathway in response to oxidative stress | 4.67e-02 |
MELK | GO:0031100 | animal organ regeneration | 4.67e-02 |
Top |
Related Drugs to MELK_P4HA1 |
Drugs used for this fusion-positive patient. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Drug | Source | PMID |
Distribution of the number of studies mentioning MELK-P4HA1 and kinase inhibitors the PubMed Abstract (04-01-2024) |
Fusion gene - drug pair 1 | Fusion gene - drug pair 2 | PMID | Publication date | DOI | Study title |
Top |
Related Diseases to MELK_P4HA1 |
Diseases that have this fusion gene. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Disease | Source | PMID |
Related diseases from the literature mentioned this fusion gene and drug. (PubMed, 04-01-2024) |
MeSH ID | MeSH term |
Diseases associated with fusion partners. (DisGeNet 4.0) |
Partner | Gene | Disease ID | Disease name | # pubmeds | Source |
Top |
Clinical Trials of the Found Drugs/Small Molecules |
Statistics of the Clinical Trials of the Found Kinase Inibitors from clinicaltrials.gov (06-17-2024) |
Clinical Trials from clinicaltrials.gov (06-17-2024) |
Fusion Gene | Kinase Inhibitor | NCT ID | Study Status | Phases | Disease | # Enrolment | Date |