UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
|
Kinase Fusion Gene:NEK9_EPC1 |
Kinase Fusion Protein Summary |
Kinase Fusion gene summary |
Kinase Fusion partner gene information | Kinase Fusion gene name: NEK9_EPC1 | KinaseFusionDB ID: KFG4164 | FusionGDB2.0 ID: KFG4164 | Hgene | Tgene | Gene symbol | NEK9 | EPC1 | Gene ID | 91754 | 80314 | |
Gene name | NIMA related kinase 9 | enhancer of polycomb homolog 1 | ||||||||||
Synonyms | APUG|LCCS10|NC|NERCC|NERCC1 | Epl1 | ||||||||||
Cytomap | 14q24.3 | 10p11.22 | ||||||||||
Type of gene | protein-coding | protein-coding | ||||||||||
Description | serine/threonine-protein kinase Nek9NIMA (never in mitosis gene a)- related kinase 9nercc1 kinasenimA-related protein kinase 9 | enhancer of polycomb homolog 1 | ||||||||||
Modification date | 20240407 | 20240305 | ||||||||||
UniProtAcc | Q8TD19 | Q9H2F5 | ||||||||||
Ensembl transtripts involved in fusion gene | ENST ids | ENST00000238616, ENST00000555763, | ENST00000480402, ENST00000263062, ENST00000319778, ENST00000375110, | |||||||||
Context (manual curation of fusion genes in KinaseFusionDB) | PubMed: NEK9 [Title/Abstract] AND EPC1 [Title/Abstract] AND fusion [Title/Abstract] | |||||||||||
Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) | NEK9(75562074)-EPC1(32562209), # samples:1 NEK9(75562075)-EPC1(32562209), # samples:1 |
Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
Partner | Gene | GO ID | GO term | PubMed ID |
Hgene | NEK9 | GO:0000278 | mitotic cell cycle | 12840024|19941817 |
Hgene | NEK9 | GO:0007346 | regulation of mitotic cell cycle | 19941817 |
Tgene | EPC1 | GO:0000122 | negative regulation of transcription by RNA polymerase II | 10976108 |
Tgene | EPC1 | GO:0000724 | double-strand break repair via homologous recombination | 27153538 |
Tgene | EPC1 | GO:0045814 | negative regulation of gene expression, epigenetic | 10976108 |
Tgene | EPC1 | GO:0045892 | negative regulation of DNA-templated transcription | 10976108 |
Tgene | EPC1 | GO:0045944 | positive regulation of transcription by RNA polymerase II | 10976108 |
Tgene | EPC1 | GO:1905168 | positive regulation of double-strand break repair via homologous recombination | 27153538 |
Kinase Fusion gene breakpoints across NEK9 (5'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Kinase Fusion gene breakpoints across EPC1 (3'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Top |
Kinase Fusion Gene Sample Information |
Kinase Fusion gene information. |
Kinase Fusion gene information from four resources (ChiTars 5.0, ChimerDB 4.0, COSMIC, and CCLE) * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
Source | Sample | Hgene | Hchr | Hbp | Tgene | Tchr | Tbp |
ChimerDB4 | TCGA-BR-8364-01A | NEK9 | chr14 | 75562075 | EPC1 | chr10 | 32562209 |
ChimerDB4 | TCGA-BR-8364 | NEK9 | chr14 | 75562074 | EPC1 | chr10 | 32562209 |
Top |
Kinase Fusion ORF Analysis |
Kinase Fusion information from ORFfinder translation from full-length transcript sequence from KinaseFusionDB. |
Henst | Tenst | Hgene | Hchr | Hbp | Tgene | Tchr | Tbp | Seq length (transcript) | Seq length (amino acids) |
ENST00000238616 | ENST00000375110 | NEK9 | chr14 | 75562074 | EPC1 | chr10 | 32562209 | 4402 | 976 |
ENST00000238616 | ENST00000375110 | NEK9 | chr14 | 75562075 | EPC1 | chr10 | 32562209 | 4402 | 976 |
Top |
Kinase Fusion Amino Acid Sequences |
For individual full-length fusion transcript sequence from KinaseFusionDB, we ran ORFfinder and chose the longest ORF among the all predicted ones. |
>Henst_Tenst_Hgene_Hchr_Hbp_Tgene_Tchr_Tbp_length(fusion AA)_AAseq >ENST00000238616_ENST00000375110_NEK9_chr14_75562074_EPC1_chr10_32562209_length(amino acids)=976 MSVLGEYERHCDSINSDFGSESGGCGDSSPGPSASQGPRAGGGAAEQEELHYIPIRVLGRGAFGEATLYRRTEDDSLVVWKEVDLTRLSE KERRDALNEIVILALLQHDNIIAYYNHFMDNTTLLIELEYCNGGNLYDKILRQKDKLFEEEMVVWYLFQIVSAVSCIHKAGILHRDIKTL NIFLTKANLIKLGDYGLAKKLNSEYSMAETLVGTPYYMSPELCQGVKYNFKSDIWAVGCVIFELLTLKRTFDATNPLNLCVKIVQGIRAM EVDSSQYSLELIQMVHSCLDQDPEQRPTADELLDRPLLRKRRREMEEKVTLLNAPTKRPRSSTVTEAPIAVVTSRTSEVYVWGGGKSTPQ KLDVIKSGCSARQVCAGNTHFAVVTVEKELYTWVNMQGGTKLHGQLGHGDKASYRQPKHVEKLQGKAIRQVSCGDDFTVCVTDEGQLYAF GSDYYGCMGVDKVAGPEVLEPMQLNFFLSNPVEQVSCGDNHVVVLTRNKEVYSWGCGEYGRLGLDSEEDYYTPQKVDVPKALIIVAVQCG CDGTFLLTQSGKVLACGLNEFNKLGLNQCMSGIINHEAYHEVPYTTSFTLAKQLSFYKIRTIAPGKTHTAAIDERGRLLTFGCNKCGQLG VGNYKKRLGINLLGGPLGGKQVIRVSCGDEFTIAATDDNHIFAWGNGGNGRLAMTPTERPHGSDICTSWPRPIFGSLHHVPDLSCRGWHT ILIVEKVLNSKTIRSNSSGLSIGTAFTAEQYQQHQQQLALMQKQQLAQIQQQQANSNSSTNTSQGFVSKTLDSASAQFAASALVTSEQLM GFKMKDDVVLGIGVNGVLPASGVYKGLHLSSTTPTALVHTSPSTAGSALLQPSNITQTSSSHSALSHQVTAANSATTQVLIGNNIRLTVP -------------------------------------------------------------- >ENST00000238616_ENST00000375110_NEK9_chr14_75562075_EPC1_chr10_32562209_length(amino acids)=976 MSVLGEYERHCDSINSDFGSESGGCGDSSPGPSASQGPRAGGGAAEQEELHYIPIRVLGRGAFGEATLYRRTEDDSLVVWKEVDLTRLSE KERRDALNEIVILALLQHDNIIAYYNHFMDNTTLLIELEYCNGGNLYDKILRQKDKLFEEEMVVWYLFQIVSAVSCIHKAGILHRDIKTL NIFLTKANLIKLGDYGLAKKLNSEYSMAETLVGTPYYMSPELCQGVKYNFKSDIWAVGCVIFELLTLKRTFDATNPLNLCVKIVQGIRAM EVDSSQYSLELIQMVHSCLDQDPEQRPTADELLDRPLLRKRRREMEEKVTLLNAPTKRPRSSTVTEAPIAVVTSRTSEVYVWGGGKSTPQ KLDVIKSGCSARQVCAGNTHFAVVTVEKELYTWVNMQGGTKLHGQLGHGDKASYRQPKHVEKLQGKAIRQVSCGDDFTVCVTDEGQLYAF GSDYYGCMGVDKVAGPEVLEPMQLNFFLSNPVEQVSCGDNHVVVLTRNKEVYSWGCGEYGRLGLDSEEDYYTPQKVDVPKALIIVAVQCG CDGTFLLTQSGKVLACGLNEFNKLGLNQCMSGIINHEAYHEVPYTTSFTLAKQLSFYKIRTIAPGKTHTAAIDERGRLLTFGCNKCGQLG VGNYKKRLGINLLGGPLGGKQVIRVSCGDEFTIAATDDNHIFAWGNGGNGRLAMTPTERPHGSDICTSWPRPIFGSLHHVPDLSCRGWHT ILIVEKVLNSKTIRSNSSGLSIGTAFTAEQYQQHQQQLALMQKQQLAQIQQQQANSNSSTNTSQGFVSKTLDSASAQFAASALVTSEQLM GFKMKDDVVLGIGVNGVLPASGVYKGLHLSSTTPTALVHTSPSTAGSALLQPSNITQTSSSHSALSHQVTAANSATTQVLIGNNIRLTVP -------------------------------------------------------------- |
Multiple Sequence Alignment of All Fusion Protein Isoforms |
Top |
Kinase Fusion Protein Functional Features |
Four levels of functional features of fusion genes Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr14:75562074/chr10:32562209) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
Main function of each fusion partner protein. (from UniProt) |
Hgene | Tgene |
NEK9 | EPC1 |
FUNCTION: Pleiotropic regulator of mitotic progression, participating in the control of spindle dynamics and chromosome separation (PubMed:12101123, PubMed:12840024, PubMed:14660563, PubMed:19941817). Phosphorylates different histones, myelin basic protein, beta-casein, and BICD2 (PubMed:11864968). Phosphorylates histone H3 on serine and threonine residues and beta-casein on serine residues (PubMed:11864968). Important for G1/S transition and S phase progression (PubMed:12840024, PubMed:14660563, PubMed:19941817). Phosphorylates NEK6 and NEK7 and stimulates their activity by releasing the autoinhibitory functions of Tyr-108 and Tyr-97 respectively (PubMed:12840024, PubMed:14660563, PubMed:19941817, PubMed:26522158). {ECO:0000269|PubMed:11864968, ECO:0000269|PubMed:12101123, ECO:0000269|PubMed:12840024, ECO:0000269|PubMed:14660563, ECO:0000269|PubMed:19941817, ECO:0000269|PubMed:26522158}. | FUNCTION: Component of the NuA4 histone acetyltransferase (HAT) complex, a multiprotein complex involved in transcriptional activation of select genes principally by acetylation of nucleosomal histones H4 and H2A (PubMed:14966270). The NuA4 complex plays a direct role in repair of DNA double-strand breaks (DSBs) by promoting homologous recombination (HR) (PubMed:27153538). The NuA4 complex is also required for spermatid development by promoting acetylation of histones: histone acetylation is required for histone replacement during the transition from round to elongating spermatids (By similarity). In the NuA4 complex, EPC1 is required to recruit MBTD1 into the complex (PubMed:32209463). {ECO:0000250|UniProtKB:Q8C9X6, ECO:0000269|PubMed:14966270, ECO:0000269|PubMed:27153538, ECO:0000269|PubMed:32209463}. |
Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
- Retained domain in the 5'-partner of fusion protein (protein functional feature from UniProt). |
Partner | Hgeneene | Hbp | Tgeneene | Tbp | ENST | BPexon | TotalExon | Protein feature loci | BPloci | TotalLen | Feature | Note |
Hgene | NEK9 | 75562074 | EPC1 | 32562209 | ENST00000238616 | 18 | 22 | 52_308 | 7441 | 980 | Domain | Note=Protein kinase;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00159 |
Hgene | NEK9 | 75562075 | EPC1 | 32562209 | ENST00000238616 | 18 | 22 | 52_308 | 7441 | 980 | Domain | Note=Protein kinase;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00159 |
- Retained domain in the 3'-partner of fusion protein (protein functional feature from UniProt). |
Partner | Hgeneene | Hbp | Tgeneene | Tbp | ENST | BPexon | TotalExon | Protein feature loci | BPloci | TotalLen | Feature | Note |
Top |
Kinase Fusion Protein Structures |
CIF files of the predicted kinase fusion proteins * Here we show the 3D structure of the fusion proteins using Mol*. AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Model confidence is shown from the pLDDT values per residue. pLDDT corresponds to the model’s prediction of its score on the local Distance Difference Test. It is a measure of local accuracy (from AlphfaFold website). To color code individual residues, we transformed individual PDB files into CIF format. |
Kinase Fusion protein CIF link (fusion AA seq ID in KinaseFusionDB) | Henst | Tenst | Hgene | Hchr | Hbp | Tgene | Tchr | Tbp | AA seq | Len(AA seq) |
PDB file >>>178_NEK9_EPC1 | ENST00000238616 | ENST00000375110 | NEK9 | chr14 | 75562075 | EPC1 | chr10 | 32562209 | MSVLGEYERHCDSINSDFGSESGGCGDSSPGPSASQGPRAGGGAAEQEELHYIPIRVLGRGAFGEATLYRRTEDDSLVVWKEVDLTRLSE KERRDALNEIVILALLQHDNIIAYYNHFMDNTTLLIELEYCNGGNLYDKILRQKDKLFEEEMVVWYLFQIVSAVSCIHKAGILHRDIKTL NIFLTKANLIKLGDYGLAKKLNSEYSMAETLVGTPYYMSPELCQGVKYNFKSDIWAVGCVIFELLTLKRTFDATNPLNLCVKIVQGIRAM EVDSSQYSLELIQMVHSCLDQDPEQRPTADELLDRPLLRKRRREMEEKVTLLNAPTKRPRSSTVTEAPIAVVTSRTSEVYVWGGGKSTPQ KLDVIKSGCSARQVCAGNTHFAVVTVEKELYTWVNMQGGTKLHGQLGHGDKASYRQPKHVEKLQGKAIRQVSCGDDFTVCVTDEGQLYAF GSDYYGCMGVDKVAGPEVLEPMQLNFFLSNPVEQVSCGDNHVVVLTRNKEVYSWGCGEYGRLGLDSEEDYYTPQKVDVPKALIIVAVQCG CDGTFLLTQSGKVLACGLNEFNKLGLNQCMSGIINHEAYHEVPYTTSFTLAKQLSFYKIRTIAPGKTHTAAIDERGRLLTFGCNKCGQLG VGNYKKRLGINLLGGPLGGKQVIRVSCGDEFTIAATDDNHIFAWGNGGNGRLAMTPTERPHGSDICTSWPRPIFGSLHHVPDLSCRGWHT ILIVEKVLNSKTIRSNSSGLSIGTAFTAEQYQQHQQQLALMQKQQLAQIQQQQANSNSSTNTSQGFVSKTLDSASAQFAASALVTSEQLM GFKMKDDVVLGIGVNGVLPASGVYKGLHLSSTTPTALVHTSPSTAGSALLQPSNITQTSSSHSALSHQVTAANSATTQVLIGNNIRLTVP | 976 |
3D view using mol* of 178_NEK9_EPC1 | ||||||||||
PDB file >>>HKFP_257_NEK9_EPC1 | ENST00000238616 | ENST00000375110 | NEK9 | chr14 | 75562074 | EPC1 | chr10 | 32562209 | MSVLGEYERHCDSINSDFGSESGGCGDSSPGPSASQGPRAGGGAAEQEELHYIPIRVLGRGAFGEATLYRRTEDDSLVVWKEVDLTRLSE KERRDALNEIVILALLQHDNIIAYYNHFMDNTTLLIELEYCNGGNLYDKILRQKDKLFEEEMVVWYLFQIVSAVSCIHKAGILHRDIKTL NIFLTKANLIKLGDYGLAKKLNSEYSMAETLVGTPYYMSPELCQGVKYNFKSDIWAVGCVIFELLTLKRTFDATNPLNLCVKIVQGIRAM EVDSSQYSLELIQMVHSCLDQDPEQRPTADELLDRPLLRKRRREMEEKVTLLNAPTKRPRSSTVTEAPIAVVTSRTSEVYVWGGGKSTPQ KLDVIKSGCSARQVCAGNTHFAVVTVEKELYTWVNMQGGTKLHGQLGHGDKASYRQPKHVEKLQGKAIRQVSCGDDFTVCVTDEGQLYAF GSDYYGCMGVDKVAGPEVLEPMQLNFFLSNPVEQVSCGDNHVVVLTRNKEVYSWGCGEYGRLGLDSEEDYYTPQKVDVPKALIIVAVQCG CDGTFLLTQSGKVLACGLNEFNKLGLNQCMSGIINHEAYHEVPYTTSFTLAKQLSFYKIRTIAPGKTHTAAIDERGRLLTFGCNKCGQLG VGNYKKRLGINLLGGPLGGKQVIRVSCGDEFTIAATDDNHIFAWGNGGNGRLAMTPTERPHGSDICTSWPRPIFGSLHHVPDLSCRGWHT ILIVEKVLNSKTIRSNSSGLSIGTAFTAEQYQQHQQQLALMQKQQLAQIQQQQANSNSSTNTSQGFVSKTLDSASAQFAASALVTSEQLM GFKMKDDVVLGIGVNGVLPASGVYKGLHLSSTTPTALVHTSPSTAGSALLQPSNITQTSSSHSALSHQVTAANSATTQVLIGNNIRLTVP | 976_NEK9_EPC1 |
PDB file >>>HKFP_258_NEK9_EPC1 | ENST00000238616 | ENST00000375110 | NEK9 | chr14 | 75562075 | EPC1 | chr10 | 32562209 | MSVLGEYERHCDSINSDFGSESGGCGDSSPGPSASQGPRAGGGAAEQEELHYIPIRVLGRGAFGEATLYRRTEDDSLVVWKEVDLTRLSE KERRDALNEIVILALLQHDNIIAYYNHFMDNTTLLIELEYCNGGNLYDKILRQKDKLFEEEMVVWYLFQIVSAVSCIHKAGILHRDIKTL NIFLTKANLIKLGDYGLAKKLNSEYSMAETLVGTPYYMSPELCQGVKYNFKSDIWAVGCVIFELLTLKRTFDATNPLNLCVKIVQGIRAM EVDSSQYSLELIQMVHSCLDQDPEQRPTADELLDRPLLRKRRREMEEKVTLLNAPTKRPRSSTVTEAPIAVVTSRTSEVYVWGGGKSTPQ KLDVIKSGCSARQVCAGNTHFAVVTVEKELYTWVNMQGGTKLHGQLGHGDKASYRQPKHVEKLQGKAIRQVSCGDDFTVCVTDEGQLYAF GSDYYGCMGVDKVAGPEVLEPMQLNFFLSNPVEQVSCGDNHVVVLTRNKEVYSWGCGEYGRLGLDSEEDYYTPQKVDVPKALIIVAVQCG CDGTFLLTQSGKVLACGLNEFNKLGLNQCMSGIINHEAYHEVPYTTSFTLAKQLSFYKIRTIAPGKTHTAAIDERGRLLTFGCNKCGQLG VGNYKKRLGINLLGGPLGGKQVIRVSCGDEFTIAATDDNHIFAWGNGGNGRLAMTPTERPHGSDICTSWPRPIFGSLHHVPDLSCRGWHT ILIVEKVLNSKTIRSNSSGLSIGTAFTAEQYQQHQQQLALMQKQQLAQIQQQQANSNSSTNTSQGFVSKTLDSASAQFAASALVTSEQLM GFKMKDDVVLGIGVNGVLPASGVYKGLHLSSTTPTALVHTSPSTAGSALLQPSNITQTSSSHSALSHQVTAANSATTQVLIGNNIRLTVP | 976_NEK9_EPC1 |
Top |
Comparison of Fusion Protein Isoforms |
Superimpose the 3D Structures Among All Fusion Protein Isoforms * Download the pdb file and open it from the molstar online viewer. |
Comparison of the Secondary Structures of Fusion Protein Isoforms |
Top |
Comparison of Fusion Protein Sequences/Structures with Known Sequences/Structures from PDB |
Top |
pLDDT score distribution |
pLDDT score distribution of the predicted fusion protein structures from AlphaFold2 * AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. * The blue color at the bottom marks the best active site residues. |
178_NEK9_EPC1.png |
178_NEK9_EPC1.png |
Top |
Potential Active Site Information |
The potential binding sites of these fusion proteins were identified using SiteMap, a module of the Schrodinger suite. |
Kinase Fusion AA seq ID in KinaseFusionDB | Site score | Size | Dscore | Volume | Exposure | Enclosure | Contact | Phobic | Philic | Balance | Don/Acc | Residues |
Top |
Ramachandran Plot of Kinase Fusion Protein Structure |
Ramachandran plot of the torsional angles - phi (φ)and psi (ψ) - of the residues (amino acids) contained in this fusion protein peptide. |
178_NEK9_EPC1_ramachandran.png |
Top |
Virtual Screening Results |
Distribution of the average docking score across all approved kinase inhibitors. Distribution of the number of occurrence across all approved kinase inhibitors. |
5'-kinase fusion protein case |
3'-kinase fusion protein case |
Top |
Drug information from DrugBank of the top 20 interacting small molecules. * The detailed information of individual kinase inhibitors are available in the download page. |
Fusion gene name info | Drug | Docking score | Glide g score | Glide energy |
178_NEK9_EPC1-DOCK_HTVS_1-001 | Mobocertinib | -6.669630000000001 | -6.67733 | -53.553999999999995 |
178_NEK9_EPC1-DOCK_HTVS_1-001 | Pazopanib | -5.77864 | -5.78554 | -44.8228 |
178_NEK9_EPC1-DOCK_HTVS_1-001 | Pazopanib | -5.77864 | -5.78554 | -44.8228 |
178_NEK9_EPC1-DOCK_HTVS_1-001 | Larotrectinib | -5.7775 | -5.7775 | -42.2876 |
178_NEK9_EPC1-DOCK_HTVS_1-001 | Temsirolimus | -5.6950400000000005 | -5.69644 | -51.786 |
178_NEK9_EPC1-DOCK_HTVS_1-001 | Netarsudil | -5.54857 | -5.55967 | -28.8455 |
178_NEK9_EPC1-DOCK_HTVS_1-001 | Netarsudil | -5.54857 | -5.55967 | -28.8455 |
178_NEK9_EPC1-DOCK_HTVS_1-001 | Tofacitinib | -5.39049 | -5.4019900000000005 | -37.1367 |
178_NEK9_EPC1-DOCK_HTVS_1-001 | Tofacitinib | -5.39049 | -5.4019900000000005 | -37.1367 |
178_NEK9_EPC1-DOCK_HTVS_1-001 | Ruxolitinib | -5.3633 | -5.3633 | -37.3568 |
178_NEK9_EPC1-DOCK_HTVS_1-001 | Tucatinib | -5.278519999999999 | -5.74132 | -46.7979 |
178_NEK9_EPC1-DOCK_HTVS_1-001 | Tucatinib | -5.278519999999999 | -5.74132 | -46.7979 |
178_NEK9_EPC1-DOCK_HTVS_1-001 | Abrocitinib | -5.25413 | -5.26523 | -42.0374 |
178_NEK9_EPC1-DOCK_HTVS_1-001 | Abrocitinib | -5.25413 | -5.26523 | -42.0374 |
178_NEK9_EPC1-DOCK_HTVS_1-001 | Pexidartinib | -5.24017 | -5.45697 | -42.6446 |
178_NEK9_EPC1-DOCK_HTVS_1-001 | Pexidartinib | -5.24017 | -5.45697 | -42.6446 |
178_NEK9_EPC1-DOCK_HTVS_1-001 | Temsirolimus | -5.23754 | -5.23894 | -51.9654 |
178_NEK9_EPC1-DOCK_HTVS_1-001 | Netarsudil | -5.21864 | -5.2297400000000005 | -46.9278 |
178_NEK9_EPC1-DOCK_HTVS_1-001 | Netarsudil | -5.21864 | -5.2297400000000005 | -46.9278 |
178_NEK9_EPC1-DOCK_HTVS_1-001 | Upadacitinib | -5.2146 | -5.2156 | -40.8568 |
Top |
Kinase-Substrate Information of NEK9_EPC1 |
Phosphorylation target of the kinase (phosphosite, 03-17-2024) |
Kinase | Kinase UniProt Acc | Kinase species | Substrate | Substrate UniProt Acc | Substrate phosphorylated residues | Substrate phosphorylated sites (+/-7AA) | Domain |
NEK9 | Q8TD19 | human | NEK9 | Q8TD19 | S944 | GQQVGMHskGTQTAK | |
NEK9 | Q8TD19 | human | NEDD1 | Q8NHV4 | S377 | EkAGLPRsINTDtLS | |
NEK9 | Q8TD19 | human | MAP1LC3B | Q9GZQ8 | T50 | QLPVLDktkFLVPDH | ATG8 |
NEK9 | Q8TD19 | human | NEK7 | Q8TDX7 | S195 | skttAAHsLVGtPyy | Pkinase |
NEK9 | Q8TD19 | human | NEK6 | Q9HC98 | S206 | sEttAAHsLVGtPyy | Pkinase |
NEK9 | Q8TD19 | human | NEK9 | Q8TD19 | T210 | SEYsMAEtLVGtPYY | Pkinase |
Biological Network Integration of This Kinase and Substrates (GeneMANIA website) |
Enriched GO biological processes of the phosphorylation target genes of the kinase |
Kinase | GOID | GO term | P.adjust |
NEK9 | ID | Description | 0.00e+00 |
NEK9 | GO:0051225 | spindle assembly | 3.68e-02 |
NEK9 | GO:0007051 | spindle organization | 3.68e-02 |
NEK9 | GO:0033044 | regulation of chromosome organization | 3.68e-02 |
NEK9 | GO:0018105 | peptidyl-serine phosphorylation | 3.68e-02 |
NEK9 | GO:0018209 | peptidyl-serine modification | 3.68e-02 |
NEK9 | GO:0051081 | nuclear membrane disassembly | 3.68e-02 |
NEK9 | GO:0030397 | membrane disassembly | 3.68e-02 |
NEK9 | GO:0006995 | cellular response to nitrogen starvation | 3.68e-02 |
NEK9 | GO:0043562 | cellular response to nitrogen levels | 3.68e-02 |
NEK9 | GO:0035865 | cellular response to potassium ion | 3.68e-02 |
NEK9 | GO:0140694 | non-membrane-bounded organelle assembly | 3.68e-02 |
NEK9 | GO:1904355 | positive regulation of telomere capping | 3.68e-02 |
NEK9 | GO:0035864 | response to potassium ion | 3.68e-02 |
NEK9 | GO:0007059 | chromosome segregation | 3.68e-02 |
NEK9 | GO:1900227 | positive regulation of NLRP3 inflammasome complex assembly | 3.71e-02 |
NEK9 | GO:0141087 | positive regulation of inflammasome-mediated signaling pathway | 3.71e-02 |
NEK9 | GO:0022411 | cellular component disassembly | 4.08e-02 |
NEK9 | GO:1904353 | regulation of telomere capping | 4.08e-02 |
NEK9 | GO:0032212 | positive regulation of telomere maintenance via telomerase | 4.08e-02 |
NEK9 | GO:0051973 | positive regulation of telomerase activity | 4.08e-02 |
NEK9 | GO:1900225 | regulation of NLRP3 inflammasome complex assembly | 4.08e-02 |
NEK9 | GO:0044546 | NLRP3 inflammasome complex assembly | 4.08e-02 |
NEK9 | GO:0141085 | regulation of inflammasome-mediated signaling pathway | 4.08e-02 |
NEK9 | GO:1904358 | positive regulation of telomere maintenance via telomere lengthening | 4.08e-02 |
NEK9 | GO:0000423 | mitophagy | 4.08e-02 |
NEK9 | GO:0016233 | telomere capping | 4.08e-02 |
NEK9 | GO:0140632 | canonical inflammasome complex assembly | 4.08e-02 |
NEK9 | GO:0141084 | inflammasome-mediated signaling pathway | 4.19e-02 |
NEK9 | GO:0071763 | nuclear membrane organization | 4.19e-02 |
NEK9 | GO:0007020 | microtubule nucleation | 4.19e-02 |
NEK9 | GO:0051972 | regulation of telomerase activity | 4.19e-02 |
NEK9 | GO:0032210 | regulation of telomere maintenance via telomerase | 4.48e-02 |
NEK9 | GO:0006998 | nuclear envelope organization | 4.48e-02 |
NEK9 | GO:2000772 | regulation of cellular senescence | 4.48e-02 |
NEK9 | GO:0097352 | autophagosome maturation | 4.75e-02 |
NEK9 | GO:1904356 | regulation of telomere maintenance via telomere lengthening | 4.77e-02 |
NEK9 | GO:0062208 | positive regulation of pattern recognition receptor signaling pathway | 4.87e-02 |
NEK9 | GO:0007004 | telomere maintenance via telomerase | 4.93e-02 |
NEK9 | GO:2000573 | positive regulation of DNA biosynthetic process | 4.93e-02 |
NEK9 | GO:0032206 | positive regulation of telomere maintenance | 4.93e-02 |
NEK9 | GO:0006278 | RNA-templated DNA biosynthetic process | 5.15e-02 |
NEK9 | GO:0010833 | telomere maintenance via telomere lengthening | 5.39e-02 |
NEK9 | GO:0030071 | regulation of mitotic metaphase/anaphase transition | 5.39e-02 |
NEK9 | GO:0039531 | regulation of viral-induced cytoplasmic pattern recognition receptor signaling pathway | 5.39e-02 |
NEK9 | GO:1902099 | regulation of metaphase/anaphase transition of cell cycle | 5.39e-02 |
NEK9 | GO:0007091 | metaphase/anaphase transition of mitotic cell cycle | 5.39e-02 |
NEK9 | GO:0046785 | microtubule polymerization | 5.39e-02 |
NEK9 | GO:0061912 | selective autophagy | 5.39e-02 |
NEK9 | GO:0044784 | metaphase/anaphase transition of cell cycle | 5.39e-02 |
Top |
Related Drugs to NEK9_EPC1 |
Drugs used for this fusion-positive patient. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Drug | Source | PMID |
Distribution of the number of studies mentioning NEK9-EPC1 and kinase inhibitors the PubMed Abstract (04-01-2024) |
Fusion gene - drug pair 1 | Fusion gene - drug pair 2 | PMID | Publication date | DOI | Study title |
Top |
Related Diseases to NEK9_EPC1 |
Diseases that have this fusion gene. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Disease | Source | PMID |
Related diseases from the literature mentioned this fusion gene and drug. (PubMed, 04-01-2024) |
MeSH ID | MeSH term |
Diseases associated with fusion partners. (DisGeNet 4.0) |
Partner | Gene | Disease ID | Disease name | # pubmeds | Source |
Top |
Clinical Trials of the Found Drugs/Small Molecules |
Statistics of the Clinical Trials of the Found Kinase Inibitors from clinicaltrials.gov (06-17-2024) |
Clinical Trials from clinicaltrials.gov (06-17-2024) |
Fusion Gene | Kinase Inhibitor | NCT ID | Study Status | Phases | Disease | # Enrolment | Date |