UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
|
Kinase Fusion Gene:OSGIN2_RIPK2 |
Kinase Fusion Protein Summary |
Kinase Fusion gene summary |
Kinase Fusion partner gene information | Kinase Fusion gene name: OSGIN2_RIPK2 | KinaseFusionDB ID: KFG4365 | FusionGDB2.0 ID: KFG4365 | Hgene | Tgene | Gene symbol | OSGIN2 | RIPK2 | Gene ID | 734 | 8767 | |
Gene name | oxidative stress induced growth inhibitor family member 2 | receptor interacting serine/threonine kinase 2 | ||||||||||
Synonyms | C8orf1|hT41 | CARD3|CARDIAK|CCK|GIG30|RICK|RIP2 | ||||||||||
Cytomap | 8q21.3 | 8q21.3 | ||||||||||
Type of gene | protein-coding | protein-coding | ||||||||||
Description | oxidative stress-induced growth inhibitor 2 | receptor-interacting serine/threonine-protein kinase 2CARD-carrying kinaseCARD-containing IL-1 beta ICE-kinaseCARD-containing interleukin-1 beta-converting enzyme (ICE)-associated kinaseRIP-2growth-inhibiting gene 30receptor-interacting protein (RIP | ||||||||||
Modification date | 20240305 | 20240411 | ||||||||||
UniProtAcc | Q9Y236 | O43353 | ||||||||||
Ensembl transtripts involved in fusion gene | ENST ids | ENST00000297438, ENST00000451899, ENST00000520659, | ENST00000540020, ENST00000220751, | |||||||||
Context (manual curation of fusion genes in KinaseFusionDB) | PubMed: OSGIN2 [Title/Abstract] AND RIPK2 [Title/Abstract] AND fusion [Title/Abstract] | |||||||||||
Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) | OSGIN2(90926974)-RIPK2(90775057), # samples:3 OSGIN2(90926974)-RIPK2(90798821), # samples:3 |
Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
Partner | Gene | GO ID | GO term | PubMed ID |
Tgene | RIPK2 | GO:0006915 | apoptotic process | 16920334 |
Tgene | RIPK2 | GO:0010800 | positive regulation of peptidyl-threonine phosphorylation | 21887730 |
Tgene | RIPK2 | GO:0032731 | positive regulation of interleukin-1 beta production | 11432859 |
Tgene | RIPK2 | GO:0033138 | positive regulation of peptidyl-serine phosphorylation | 21887730 |
Tgene | RIPK2 | GO:0034134 | toll-like receptor 2 signaling pathway | 11894098 |
Tgene | RIPK2 | GO:0042742 | defense response to bacterium | 16824733|29452636 |
Tgene | RIPK2 | GO:0043123 | positive regulation of canonical NF-kappaB signal transduction | 10329646 |
Tgene | RIPK2 | GO:0045087 | innate immune response | 23806334 |
Tgene | RIPK2 | GO:0050731 | positive regulation of peptidyl-tyrosine phosphorylation | 21887730 |
Tgene | RIPK2 | GO:0051092 | positive regulation of NF-kappaB transcription factor activity | 11821383|29452636|30026309|30279485|30478312 |
Tgene | RIPK2 | GO:0051260 | protein homooligomerization | 30279485|30478312 |
Tgene | RIPK2 | GO:0070427 | nucleotide-binding oligomerization domain containing 1 signaling pathway | 29452636|30279485 |
Tgene | RIPK2 | GO:0070431 | nucleotide-binding oligomerization domain containing 2 signaling pathway | 16824733|17355968|17562858|23806334|28545134|29452636|30026309|30279485|30478312 |
Tgene | RIPK2 | GO:0071225 | cellular response to muramyl dipeptide | 21887730 |
Tgene | RIPK2 | GO:0097202 | activation of cysteine-type endopeptidase activity | 11821383 |
Tgene | RIPK2 | GO:1902523 | positive regulation of protein K63-linked ubiquitination | 17562858 |
Kinase Fusion gene breakpoints across OSGIN2 (5'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Kinase Fusion gene breakpoints across RIPK2 (3'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Top |
Kinase Fusion Gene Sample Information |
Kinase Fusion gene information. |
Kinase Fusion gene information from four resources (ChiTars 5.0, ChimerDB 4.0, COSMIC, and CCLE) * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
Source | Sample | Hgene | Hchr | Hbp | Tgene | Tchr | Tbp |
ChimerDB4 | TCGA-OL-A6VO-01A | OSGIN2 | chr8 | 90926974 | RIPK2 | chr8 | 90775057 |
ChimerDB4 | TCGA-86-7711-01A | OSGIN2 | chr8 | 90921949 | RIPK2 | chr8 | 90801549 |
ChimerDB4 | TCGA-CV-5430-01A | OSGIN2 | chr8 | 90926974 | RIPK2 | chr8 | 90798821 |
Top |
Kinase Fusion ORF Analysis |
Kinase Fusion information from ORFfinder translation from full-length transcript sequence from KinaseFusionDB. |
Henst | Tenst | Hgene | Hchr | Hbp | Tgene | Tchr | Tbp | Seq length (transcript) | Seq length (amino acids) |
ENST00000297438 | ENST00000220751 | OSGIN2 | chr8 | 90926974 | RIPK2 | chr8 | 90798821 | 1992 | 336 |
ENST00000297438 | ENST00000220751 | OSGIN2 | chr8 | 90921949 | RIPK2 | chr8 | 90801549 | 1569 | 195 |
Top |
Kinase Fusion Amino Acid Sequences |
For individual full-length fusion transcript sequence from KinaseFusionDB, we ran ORFfinder and chose the longest ORF among the all predicted ones. |
>Henst_Tenst_Hgene_Hchr_Hbp_Tgene_Tchr_Tbp_length(fusion AA)_AAseq >ENST00000297438_ENST00000220751_OSGIN2_chr8_90926974_RIPK2_chr8_90798821_length(amino acids)=336 MGRKVKAMPLVEETSLLEDSSVTFPVVIIGNGPSGICLSYMLSGYRPYLSSEAIHPNTILNSKLEEARHLSIVDQDLEYLSEGLEGRSSN PVAVLFDTLLHPDADFGYDYPSVLHWKLEQHHYIPHVVLGKGPPGGAWHESCGSSQLHENSGSPETSRSLPAPQDNDFLSRKAQDCYFMK LHHCPGNHSWDSTISGSQRAAFCDHKTTPCSSAIINPLSTAGNSERLQPGIAQQWIQSKREDIVNQMTEACLNQSLDALLSRDLIMKEDY -------------------------------------------------------------- >ENST00000297438_ENST00000220751_OSGIN2_chr8_90921949_RIPK2_chr8_90801549_length(amino acids)=195 MGRKVKAMPLVEETSLLEDSSVTFPVVIIGKAQDCYFMKLHHCPGNHSWDSTISGSQRAAFCDHKTTPCSSAIINPLSTAGNSERLQPGI AQQWIQSKREDIVNQMTEACLNQSLDALLSRDLIMKEDYELVSTKPTRTSKVRQLLDTTDIQGEEFAKVIVQKLKDNKQMGLQPYPEILV -------------------------------------------------------------- |
Multiple Sequence Alignment of All Fusion Protein Isoforms |
Top |
Kinase Fusion Protein Functional Features |
Four levels of functional features of fusion genes Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr8:90926974/chr8:90775057) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
Main function of each fusion partner protein. (from UniProt) |
Hgene | Tgene |
OSGIN2 | RIPK2 |
FUNCTION: May be involved in meiosis or the maturation of germ cells. | FUNCTION: Serine/threonine/tyrosine-protein kinase that plays an essential role in modulation of innate and adaptive immune responses (PubMed:9575181, PubMed:9642260, PubMed:14638696, PubMed:21123652, PubMed:17054981, PubMed:28656966). Acts as a key effector of NOD1 and NOD2 signaling pathways: upon activation by bacterial peptidoglycans, NOD1 and NOD2 oligomerize and recruit RIPK2 via CARD-CARD domains, leading to the formation of RIPK2 filaments (PubMed:17562858, PubMed:21123652, PubMed:17054981, PubMed:22607974, PubMed:28656966, PubMed:29452636, PubMed:30026309). Once recruited, RIPK2 autophosphorylates and undergoes 'Lys-63'-linked polyubiquitination by E3 ubiquitin ligases XIAP, BIRC2 and BIRC3, as well as 'Met-1'-linked (linear) polyubiquitination by the LUBAC complex, becoming a scaffolding protein for downstream effectors (PubMed:22607974, PubMed:29452636, PubMed:28545134, PubMed:30279485, PubMed:30478312, PubMed:30026309). 'Met-1'-linked polyubiquitin chains attached to RIPK2 recruit IKBKG/NEMO, which undergoes 'Lys-63'-linked polyubiquitination in a RIPK2-dependent process (PubMed:22607974, PubMed:17562858, PubMed:29452636, PubMed:30026309). 'Lys-63'-linked polyubiquitin chains attached to RIPK2 serve as docking sites for TAB2 and TAB3 and mediate the recruitment of MAP3K7/TAK1 to IKBKG/NEMO, inducing subsequent activation of IKBKB/IKKB (PubMed:18079694). In turn, NF-kappa-B is released from NF-kappa-B inhibitors and translocates into the nucleus where it activates the transcription of hundreds of genes involved in immune response, growth control, or protection against apoptosis (PubMed:18079694). The protein kinase activity is dispensable for the NOD1 and NOD2 signaling pathways (PubMed:29452636, PubMed:30026309). Contributes to the tyrosine phosphorylation of the guanine exchange factor ARHGEF2 through Src tyrosine kinase leading to NF-kappa-B activation by NOD2 (PubMed:21887730). Also involved in adaptive immunity: plays a role during engagement of the T-cell receptor (TCR) in promoting BCL10 phosphorylation and subsequent NF-kappa-B activation (PubMed:14638696). Plays a role in the inactivation of RHOA in response to NGFR signaling (PubMed:26646181). {ECO:0000269|PubMed:14638696, ECO:0000269|PubMed:17054981, ECO:0000269|PubMed:17562858, ECO:0000269|PubMed:18079694, ECO:0000269|PubMed:21123652, ECO:0000269|PubMed:21887730, ECO:0000269|PubMed:22607974, ECO:0000269|PubMed:26646181, ECO:0000269|PubMed:28545134, ECO:0000269|PubMed:28656966, ECO:0000269|PubMed:29452636, ECO:0000269|PubMed:30026309, ECO:0000269|PubMed:30279485, ECO:0000269|PubMed:30478312, ECO:0000269|PubMed:9575181, ECO:0000269|PubMed:9642260}. |
Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
- Retained domain in the 5'-partner of fusion protein (protein functional feature from UniProt). |
Partner | Hgeneene | Hbp | Tgeneene | Tbp | ENST | BPexon | TotalExon | Protein feature loci | BPloci | TotalLen | Feature | Note |
- Retained domain in the 3'-partner of fusion protein (protein functional feature from UniProt). |
Partner | Hgeneene | Hbp | Tgeneene | Tbp | ENST | BPexon | TotalExon | Protein feature loci | BPloci | TotalLen | Feature | Note |
Tgene | OSGIN2 | 90921949 | RIPK2 | 90801549 | ENST00000297438 | 7 | 10 | 432_524 | 237 | 404 | Domain | Note=CARD;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00046 |
Tgene | OSGIN2 | 90921949 | RIPK2 | 90801549 | ENST00000297438 | 8 | 11 | 432_524 | 374 | 541 | Domain | Note=CARD;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00046 |
Tgene | OSGIN2 | 90926974 | RIPK2 | 90798821 | ENST00000297438 | 6 | 10 | 432_524 | 206 | 404 | Domain | Note=CARD;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00046 |
Tgene | OSGIN2 | 90926974 | RIPK2 | 90798821 | ENST00000297438 | 7 | 11 | 432_524 | 343 | 541 | Domain | Note=CARD;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00046 |
Top |
Kinase Fusion Protein Structures |
CIF files of the predicted kinase fusion proteins * Here we show the 3D structure of the fusion proteins using Mol*. AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Model confidence is shown from the pLDDT values per residue. pLDDT corresponds to the model’s prediction of its score on the local Distance Difference Test. It is a measure of local accuracy (from AlphfaFold website). To color code individual residues, we transformed individual PDB files into CIF format. |
Kinase Fusion protein CIF link (fusion AA seq ID in KinaseFusionDB) | Henst | Tenst | Hgene | Hchr | Hbp | Tgene | Tchr | Tbp | AA seq | Len(AA seq) |
PDB file >>>356_OSGIN2_RIPK2 | ENST00000297438 | ENST00000220751 | OSGIN2 | chr8 | 90921949 | RIPK2 | chr8 | 90801549 | MGRKVKAMPLVEETSLLEDSSVTFPVVIIGKAQDCYFMKLHHCPGNHSWDSTISGSQRAAFCDHKTTPCSSAIINPLSTAGNSERLQPGI AQQWIQSKREDIVNQMTEACLNQSLDALLSRDLIMKEDYELVSTKPTRTSKVRQLLDTTDIQGEEFAKVIVQKLKDNKQMGLQPYPEILV | 195 |
3D view using mol* of 356_OSGIN2_RIPK2 | ||||||||||
PDB file >>>TKFP_608_OSGIN2_RIPK2 | ENST00000297438 | ENST00000220751 | OSGIN2 | chr8 | 90926974 | RIPK2 | chr8 | 90798821 | MGRKVKAMPLVEETSLLEDSSVTFPVVIIGNGPSGICLSYMLSGYRPYLSSEAIHPNTILNSKLEEARHLSIVDQDLEYLSEGLEGRSSN PVAVLFDTLLHPDADFGYDYPSVLHWKLEQHHYIPHVVLGKGPPGGAWHESCGSSQLHENSGSPETSRSLPAPQDNDFLSRKAQDCYFMK LHHCPGNHSWDSTISGSQRAAFCDHKTTPCSSAIINPLSTAGNSERLQPGIAQQWIQSKREDIVNQMTEACLNQSLDALLSRDLIMKEDY | 336_OSGIN2_RIPK2 |
PDB file >>>TKFP_609_OSGIN2_RIPK2 | ENST00000297438 | ENST00000220751 | OSGIN2 | chr8 | 90921949 | RIPK2 | chr8 | 90801549 | MGRKVKAMPLVEETSLLEDSSVTFPVVIIGKAQDCYFMKLHHCPGNHSWDSTISGSQRAAFCDHKTTPCSSAIINPLSTAGNSERLQPGI AQQWIQSKREDIVNQMTEACLNQSLDALLSRDLIMKEDYELVSTKPTRTSKVRQLLDTTDIQGEEFAKVIVQKLKDNKQMGLQPYPEILV | 195_OSGIN2_RIPK2 |
3D view using mol* of TKFP_609_OSGIN2_RIPK2 | ||||||||||
Top |
Comparison of Fusion Protein Isoforms |
Superimpose the 3D Structures Among All Fusion Protein Isoforms * Download the pdb file and open it from the molstar online viewer. |
3D view using mol* of viewer/superimpose_isoforms/TKFP_608_OSGIN2_RIPK2_vs_TKFP_609_OSGIN2_RIPK2_superimposed.pdb.html |
Comparison of the Secondary Structures of Fusion Protein Isoforms |
./secondary_str/TKFP_609_OSGIN2_RIPK2_vs_TKFP_608_OSGIN2_RIPK2.png |
Top |
Comparison of Fusion Protein Sequences/Structures with Known Sequences/Structures from PDB |
Top |
pLDDT score distribution |
pLDDT score distribution of the predicted fusion protein structures from AlphaFold2 * AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. * The blue color at the bottom marks the best active site residues. |
356_OSGIN2_RIPK2.png |
356_OSGIN2_RIPK2.png |
TKFP_609_OSGIN2_RIPK2.png |
Top |
Potential Active Site Information |
The potential binding sites of these fusion proteins were identified using SiteMap, a module of the Schrodinger suite. |
Kinase Fusion AA seq ID in KinaseFusionDB | Site score | Size | Dscore | Volume | Exposure | Enclosure | Contact | Phobic | Philic | Balance | Don/Acc | Residues |
TKFP_609_OSGIN2_RIPK2 | 0.685 | 50 | 0.612 | 69.286 | 0.686 | 0.548 | 0.804 | 0.088 | 1.171 | 0.075 | 0.614 | Chain A: 82,84,85,86,87,88,89,92,152,153,154,155 |
Top |
Ramachandran Plot of Kinase Fusion Protein Structure |
Ramachandran plot of the torsional angles - phi (φ)and psi (ψ) - of the residues (amino acids) contained in this fusion protein peptide. |
356_OSGIN2_RIPK2_ramachandran.png |
TKFP_609_OSGIN2_RIPK2_ramachandran.png |
Top |
Virtual Screening Results |
Distribution of the average docking score across all approved kinase inhibitors. Distribution of the number of occurrence across all approved kinase inhibitors. |
5'-kinase fusion protein case |
3'-kinase fusion protein case |
Top |
Drug information from DrugBank of the top 20 interacting small molecules. * The detailed information of individual kinase inhibitors are available in the download page. |
Fusion gene name info | Drug | Docking score | Glide g score | Glide energy |
Top |
Kinase-Substrate Information of OSGIN2_RIPK2 |
Phosphorylation target of the kinase (phosphosite, 03-17-2024) |
Kinase | Kinase UniProt Acc | Kinase species | Substrate | Substrate UniProt Acc | Substrate phosphorylated residues | Substrate phosphorylated sites (+/-7AA) | Domain |
RIPK2 | O43353 | human | RIPK2 | O43353 | S181 | sLsQsRsskSAPEGG | PK_Tyr_Ser-Thr |
RIPK2 | O43353 | human | RIPK2 | O43353 | S180 | MsLsQsRsskSAPEG | PK_Tyr_Ser-Thr |
RIPK2 | O43353 | human | RIPK2 | O43353 | S174 | LsKWRMMsLsQsRss | PK_Tyr_Ser-Thr |
RIPK2 | O43353 | human | RIPK2 | O43353 | S176 | KWRMMsLsQsRsskS | PK_Tyr_Ser-Thr |
RIPK2 | O43353 | human | RIPK2 | O43353 | S178 | RMMsLsQsRsskSAP | PK_Tyr_Ser-Thr |
RIPK2 | O43353 | human | RIPK2 | O43353 | Y474 | DLIMKEDyELVSTkP | CARD |
Biological Network Integration of This Kinase and Substrates (GeneMANIA website) |
Enriched GO biological processes of the phosphorylation target genes of the kinase |
Kinase | GOID | GO term | P.adjust |
RIPK2 | ID | Description | 0.00e+00 |
RIPK2 | GO:0070391 | response to lipoteichoic acid | 1.19e-02 |
RIPK2 | GO:0071223 | cellular response to lipoteichoic acid | 1.19e-02 |
RIPK2 | GO:2000563 | positive regulation of CD4-positiv | 5.30e-04 |
RIPK2 | GO:0070673 | response to interleukin-18 | 1.19e-02 |
RIPK2 | GO:0033083 | regulation of immature T cell proliferation | 1.19e-02 |
RIPK2 | GO:0033084 | regulation of immature T cell proliferation in thymus | 1.19e-02 |
RIPK2 | GO:0070671 | response to interleukin-12 | 1.19e-02 |
RIPK2 | GO:0032494 | response to peptidoglycan | 1.19e-02 |
RIPK2 | GO:0033079 | immature T cell proliferation | 1.19e-02 |
RIPK2 | GO:0033080 | immature T cell proliferation in thymus | 1.19e-02 |
RIPK2 | GO:0097202 | activation of cysteine-type endopeptidase activity | 1.19e-02 |
RIPK2 | GO:0098792 | xenophagy | 1.19e-02 |
RIPK2 | GO:1900044 | regulation of protein K63-linked ubiquitination | 1.19e-02 |
RIPK2 | GO:0034134 | toll-like receptor 2 signaling pathway | 1.19e-02 |
RIPK2 | GO:1902916 | positive regulation of protein polyubiquitination | 1.19e-02 |
RIPK2 | GO:0002827 | positive regulation of T-helper 1 type immune response | 1.19e-02 |
RIPK2 | GO:0070431 | nucleotide-binding oligomerization domain containing 2 signaling pathway | 1.19e-02 |
RIPK2 | GO:0032495 | response to muramyl dipeptide | 1.19e-02 |
RIPK2 | GO:0035739 | CD4-positiv | 1.17e-03 |
RIPK2 | GO:2000561 | regulation of CD4-positiv | 1.17e-03 |
RIPK2 | GO:0032727 | positive regulation of interferon-alpha production | 1.19e-02 |
RIPK2 | GO:0060907 | positive regulation of macrophage cytokine production | 1.19e-02 |
RIPK2 | GO:0046641 | positive regulation of alpha-beta T cell proliferation | 1.19e-02 |
RIPK2 | GO:0070423 | nucleotide-binding oligomerization domain containing signaling pathway | 1.19e-02 |
RIPK2 | GO:1902914 | regulation of protein polyubiquitination | 1.19e-02 |
RIPK2 | GO:0010800 | positive regulation of peptidyl-threonine phosphorylation | 1.19e-02 |
RIPK2 | GO:0035872 | nucleotide-binding domai | 1.54e-03 |
RIPK2 | GO:0032647 | regulation of interferon-alpha production | 1.19e-02 |
RIPK2 | GO:0002825 | regulation of T-helper 1 type immune response | 1.19e-02 |
RIPK2 | GO:0032743 | positive regulation of interleukin-2 production | 1.24e-02 |
RIPK2 | GO:0043372 | positive regulation of CD4-positiv | 1.80e-03 |
RIPK2 | GO:0010934 | macrophage cytokine production | 1.24e-02 |
RIPK2 | GO:0010935 | regulation of macrophage cytokine production | 1.24e-02 |
RIPK2 | GO:0032728 | positive regulation of interferon-beta production | 1.25e-02 |
RIPK2 | GO:0032735 | positive regulation of interleukin-12 production | 1.25e-02 |
RIPK2 | GO:0045622 | regulation of T-helper cell differentiation | 1.25e-02 |
RIPK2 | GO:0046640 | regulation of alpha-beta T cell proliferation | 1.25e-02 |
RIPK2 | GO:2000516 | positive regulation of CD4-positiv | 2.33e-03 |
RIPK2 | GO:0046633 | alpha-beta T cell proliferation | 1.25e-02 |
RIPK2 | GO:0042088 | T-helper 1 type immune response | 1.25e-02 |
RIPK2 | GO:0043330 | response to exogenous dsRNA | 1.25e-02 |
RIPK2 | GO:0061082 | myeloid leukocyte cytokine production | 1.25e-02 |
RIPK2 | GO:0046638 | positive regulation of alpha-beta T cell differentiation | 1.25e-02 |
RIPK2 | GO:0034142 | toll-like receptor 4 signaling pathway | 1.25e-02 |
RIPK2 | GO:0043370 | regulation of CD4-positiv | 2.97e-03 |
RIPK2 | GO:0031663 | lipopolysaccharide-mediated signaling pathway | 1.25e-02 |
RIPK2 | GO:0070534 | protein K63-linked ubiquitination | 1.25e-02 |
RIPK2 | GO:0031638 | zymogen activation | 1.25e-02 |
RIPK2 | GO:0032608 | interferon-beta production | 1.25e-02 |
Top |
Related Drugs to OSGIN2_RIPK2 |
Drugs used for this fusion-positive patient. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Drug | Source | PMID |
Distribution of the number of studies mentioning OSGIN2-RIPK2 and kinase inhibitors the PubMed Abstract (04-01-2024) |
Fusion gene - drug pair 1 | Fusion gene - drug pair 2 | PMID | Publication date | DOI | Study title |
Top |
Related Diseases to OSGIN2_RIPK2 |
Diseases that have this fusion gene. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Disease | Source | PMID |
Related diseases from the literature mentioned this fusion gene and drug. (PubMed, 04-01-2024) |
MeSH ID | MeSH term |
Diseases associated with fusion partners. (DisGeNet 4.0) |
Partner | Gene | Disease ID | Disease name | # pubmeds | Source |
Top |
Clinical Trials of the Found Drugs/Small Molecules |
Statistics of the Clinical Trials of the Found Kinase Inibitors from clinicaltrials.gov (06-17-2024) |
Clinical Trials from clinicaltrials.gov (06-17-2024) |
Fusion Gene | Kinase Inhibitor | NCT ID | Study Status | Phases | Disease | # Enrolment | Date |