UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY

Home

Download

Statistics

Examples

Help

Contact

	Kinase Fusion Gene Summary
	Kinase Fusion Gene Sample Information
	Kinase Fusion ORF Analysis
	Kinase Fusion Amino Acid Sequences
	Multiple Sequence Alignment of All Fusion Protein Isoforms
	Kinase Fusion Protein Functional Features
	Kinase Fusion Protein Structures
	Comparison of Fusion Protein Isoforms
	Comparison of Fusion Protein Sequences/Structures with Known Sequences/Structures from PDB
	pLDDT Scores and Difference Analysis of pLDDT Scores Between the Active Sites (Best) and Non-Active Sites.
	Ramachandran Plot of Kinase Fusion Protein Structure
	Potential Active Site Information
	Virtual Screening Results
	Kinase-Substrate Information
	Related Drugs with This Kinase Fusion Protein
	Related Disease with This Kinase Fusion Protein
	Clinical Trials of the Found Drugs/Small Molecules

Kinase Fusion Gene:PAK1_PAK2

Kinase Fusion Protein Summary

Kinase Fusion gene summary

Kinase Fusion partner gene information	Kinase Fusion gene name: PAK1_PAK2
	KinaseFusionDB ID: KFG4422
	FusionGDB2.0 ID: KFG4422
		Hgene	Tgene
	Gene symbol	PAK1	PAK2
	Gene ID	5585	5586
	Gene name	protein kinase N1	protein kinase N2
	Synonyms	DBK\|PAK-1\|PAK1\|PKN\|PKN-ALPHA\|PRK1\|PRKCL1	PAK2\|PRK2\|PRKCL2\|PRO2042\|Pak-2\|STK7
	Cytomap	19p13.12	1p22.2
	Type of gene	protein-coding	protein-coding
	Description	serine/threonine-protein kinase N1protease-activated kinase 1protein kinase C-like 1protein kinase C-like PKNprotein kinase C-related kinase 1protein kinase PKN-alphaserine-threonine kinase Nserine/threonine protein kinase N	serine/threonine-protein kinase N2PKN gammacardiolipin-activated protein kinase Pak2protein kinase C-like 2protein-kinase C-related kinase 2
	Modification date	20240305	20240323
	UniProtAcc	Q16512	Q13177
Ensembl transtripts involved in fusion gene	ENST ids	ENST00000356341, ENST00000530617, ENST00000278568, ENST00000528203, ENST00000525542,	ENST00000327134,
Context (manual curation of fusion genes in KinaseFusionDB)	PubMed: PAK1 [Title/Abstract] AND PAK2 [Title/Abstract] AND fusion [Title/Abstract]
Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0)

Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez

Partner	Gene	GO ID	GO term	PubMed ID
Hgene	PAK1	GO:0006357	regulation of transcription by RNA polymerase II	12514133
Hgene	PAK1	GO:0006468	protein phosphorylation	17332740
Hgene	PAK1	GO:0043687	post-translational protein modification	18066052
Tgene	PAK2	GO:0006468	protein phosphorylation	17332740
Tgene	PAK2	GO:0010631	epithelial cell migration	21754995

Kinase Fusion gene breakpoints across PAK1 (5'-gene)
* Click on the image to open the UCSC genome browser with custom track showing this image in a new window.

Kinase Fusion gene breakpoints across PAK2 (3'-gene)
* Click on the image to open the UCSC genome browser with custom track showing this image in a new window.

Top

Kinase Fusion Gene Sample Information

Kinase Fusion gene information.

Kinase Fusion gene information from four resources (ChiTars 5.0, ChimerDB 4.0, COSMIC, and CCLE)
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.

Source	Sample	Hgene	Hchr	Hbp	Tgene	Tchr	Tbp
CCLE	MDA-MB-134-VI	PAK1	chr11	77047130	PAK2	chr3	196547409

Top

Kinase Fusion ORF Analysis

Kinase Fusion information from ORFfinder translation from full-length transcript sequence from KinaseFusionDB.

Henst	Tenst	Hgene	Hchr	Hbp	Tgene	Tchr	Tbp	Seq length (transcript)	Seq length (amino acids)
ENST00000530617	ENST00000327134	PAK1	chr11	77047130	PAK2	chr3	196547409	6221	485

Top

Kinase Fusion Amino Acid Sequences

For individual full-length fusion transcript sequence from KinaseFusionDB, we ran ORFfinder and chose the longest ORF among the all predicted ones.

>Henst_Tenst_Hgene_Hchr_Hbp_Tgene_Tchr_Tbp_length(fusion AA)_AAseq

>ENST00000530617_ENST00000327134_PAK1_chr11_77047130_PAK2_chr3_196547409_length(amino acids)=485
MLLVVTMSNNGLDIQDKPPAPPMRNTSTMIGAGSKDAGTLNHGSKPLPPNPEEKKKKDRFYRSILPGDKTNKKKEKERPEISLPSDFEHT
IHVGFDAVTGEFTGMPEQWARLLQTSNITKSEQKKNPQAVLDVLEFYNSKKTSNSQKYMSFTDKSAEDYNSSNALNVKAVSETPAVPPVS
EDEDDDDDDATPPPVIAPRPEHTKSVYTRSVIEPLPVTPTRDVATSPISPTENNTTPPDALTRNTEKQKKKPKMSDEEILEKLRSIVSVG
DPKKKYTRFEKIGQGASGTVYTAMDVATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTD
VVTETCMDEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPK

--------------------------------------------------------------

Multiple Sequence Alignment of All Fusion Protein Isoforms

Top

Kinase Fusion Protein Functional Features

Four levels of functional features of fusion genes
Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr11:/chr3:)
- FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels.
- How to search
1. Put your fusion gene symbol.
2. Press the tab key until there will be shown the breakpoint information filled.
4. Go down and press 'Search' tab twice.
4. Go down to have the hyperlink of the search result.
5. Click the hyperlink.
6. See the FGviewer result for your fusion gene.

Main function of each fusion partner protein. (from UniProt)

Hgene	Tgene
PAK1 Q16512	PAK2 Q13177
FUNCTION: PKC-related serine/threonine-protein kinase involved in various processes such as regulation of the intermediate filaments of the actin cytoskeleton, cell migration, tumor cell invasion and transcription regulation. Part of a signaling cascade that begins with the activation of the adrenergic receptor ADRA1B and leads to the activation of MAPK14. Regulates the cytoskeletal network by phosphorylating proteins such as VIM and neurofilament proteins NEFH, NEFL and NEFM, leading to inhibit their polymerization. Phosphorylates 'Ser-575', 'Ser-637' and 'Ser-669' of MAPT/Tau, lowering its ability to bind to microtubules, resulting in disruption of tubulin assembly. Acts as a key coactivator of androgen receptor (AR)-dependent transcription, by being recruited to AR target genes and specifically mediating phosphorylation of 'Thr-11' of histone H3 (H3T11ph), a specific tag for epigenetic transcriptional activation that promotes demethylation of histone H3 'Lys-9' (H3K9me) by KDM4C/JMJD2C. Phosphorylates HDAC5, HDAC7 and HDAC9, leading to impair their import in the nucleus. Phosphorylates 'Thr-38' of PPP1R14A, 'Ser-159', 'Ser-163' and 'Ser-170' of MARCKS, and GFAP. Able to phosphorylate RPS6 in vitro. {ECO:0000269\|PubMed:11104762, ECO:0000269\|PubMed:12514133, ECO:0000269\|PubMed:17332740, ECO:0000269\|PubMed:18066052, ECO:0000269\|PubMed:20188095, ECO:0000269\|PubMed:21224381, ECO:0000269\|PubMed:21754995, ECO:0000269\|PubMed:24248594, ECO:0000269\|PubMed:8557118, ECO:0000269\|PubMed:8621664, ECO:0000269\|PubMed:9175763}.	FUNCTION: Serine/threonine protein kinase that plays a role in a variety of different signaling pathways including cytoskeleton regulation, cell motility, cell cycle progression, apoptosis or proliferation (PubMed:7744004, PubMed:19273597, PubMed:19923322, PubMed:9171063, PubMed:12853446, PubMed:16617111, PubMed:33693784). Acts as a downstream effector of the small GTPases CDC42 and RAC1 (PubMed:7744004). Activation by the binding of active CDC42 and RAC1 results in a conformational change and a subsequent autophosphorylation on several serine and/or threonine residues (PubMed:7744004). Full-length PAK2 stimulates cell survival and cell growth (PubMed:7744004). Phosphorylates MAPK4 and MAPK6 and activates the downstream target MAPKAPK5, a regulator of F-actin polymerization and cell migration (PubMed:21317288). Phosphorylates JUN and plays an important role in EGF-induced cell proliferation (PubMed:21177766). Phosphorylates many other substrates including histone H4 to promote assembly of H3.3 and H4 into nucleosomes, BAD, ribosomal protein S6, or MBP (PubMed:21724829). Phosphorylates CASP7, thereby preventing its activity (PubMed:21555521, PubMed:27889207). Additionally, associates with ARHGEF7 and GIT1 to perform kinase-independent functions such as spindle orientation control during mitosis (PubMed:19273597, PubMed:19923322). On the other hand, apoptotic stimuli such as DNA damage lead to caspase-mediated cleavage of PAK2, generating PAK-2p34, an active p34 fragment that translocates to the nucleus and promotes cellular apoptosis involving the JNK signaling pathway (PubMed:9171063, PubMed:12853446, PubMed:16617111). Caspase-activated PAK2 phosphorylates MKNK1 and reduces cellular translation (PubMed:15234964). {ECO:0000269\|PubMed:12853446, ECO:0000269\|PubMed:15234964, ECO:0000269\|PubMed:16617111, ECO:0000269\|PubMed:19273597, ECO:0000269\|PubMed:19923322, ECO:0000269\|PubMed:21177766, ECO:0000269\|PubMed:21317288, ECO:0000269\|PubMed:21555521, ECO:0000269\|PubMed:21724829, ECO:0000269\|PubMed:27889207, ECO:0000269\|PubMed:33693784, ECO:0000269\|PubMed:7744004, ECO:0000269\|PubMed:9171063}.

Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at
download page
* Minus value of BPloci means that the break pointn is located before the CDS.

- Retained domain in the 5'-partner of fusion protein (protein functional feature from UniProt).

471471

Partner

Hgeneene

Hbp

Tgeneene

Tbp

ENST

BPexon

TotalExon

Protein feature loci

BPloci

TotalLen

Feature

Note

Hgene

PAK1

77047130

PAK2

196547409

ENST00000530617

75_88

546

Domain

Note=CRIB;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00057

Hgene

PAK1

77047130

PAK2

196547409

ENST00000530617

75_88

554

Domain

Note=CRIB;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00057

- Retained domain in the 3'-partner of fusion protein (protein functional feature from UniProt).

Partner

Hgeneene

Hbp

Tgeneene

Tbp

ENST

BPexon

TotalExon

Protein feature loci

BPloci

TotalLen

Feature

Note

Tgene

PAK1

77047130

PAK2

196547409

ENST00000530617

74_87

525

Domain

Note=CRIB;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00057

Tgene

PAK1

77047130

PAK2

196547409

ENST00000530617

249_499

525

Domain

Note=Protein kinase;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00159

Top

Kinase Fusion Protein Structures

CIF files of the predicted kinase fusion proteins
* Here we show the 3D structure of the fusion proteins using Mol*. AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Model confidence is shown from the pLDDT values per residue. pLDDT corresponds to the model’s prediction of its score on the local Distance Difference Test. It is a measure of local accuracy (from AlphfaFold website). To color code individual residues, we transformed individual PDB files into CIF format.

Kinase Fusion protein CIF link (fusion AA seq ID in KinaseFusionDB)	Henst	Tenst	Hgene	Hchr	Hbp	Tgene	Tchr	Tbp	AA seq	Len(AA seq)
PDB file >>>189_PAK1_PAK2	ENST00000530617	ENST00000327134	PAK1	chr11	77047130	PAK2	chr3	196547409	MLLVVTMSNNGLDIQDKPPAPPMRNTSTMIGAGSKDAGTLNHGSKPLPPNPEEKKKKDRFYRSILPGDKTNKKKEKERPEISLPSDFEHT IHVGFDAVTGEFTGMPEQWARLLQTSNITKSEQKKNPQAVLDVLEFYNSKKTSNSQKYMSFTDKSAEDYNSSNALNVKAVSETPAVPPVS EDEDDDDDDATPPPVIAPRPEHTKSVYTRSVIEPLPVTPTRDVATSPISPTENNTTPPDALTRNTEKQKKKPKMSDEEILEKLRSIVSVG DPKKKYTRFEKIGQGASGTVYTAMDVATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTD VVTETCMDEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPK	485
3D view using mol* of 189_PAK1_PAK2

PDB file >>>HKFP_275_PAK1_PAK2	ENST00000530617	ENST00000327134	PAK1	chr11	77047130	PAK2	chr3	196547409	MLLVVTMSNNGLDIQDKPPAPPMRNTSTMIGAGSKDAGTLNHGSKPLPPNPEEKKKKDRFYRSILPGDKTNKKKEKERPEISLPSDFEHT IHVGFDAVTGEFTGMPEQWARLLQTSNITKSEQKKNPQAVLDVLEFYNSKKTSNSQKYMSFTDKSAEDYNSSNALNVKAVSETPAVPPVS EDEDDDDDDATPPPVIAPRPEHTKSVYTRSVIEPLPVTPTRDVATSPISPTENNTTPPDALTRNTEKQKKKPKMSDEEILEKLRSIVSVG DPKKKYTRFEKIGQGASGTVYTAMDVATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTD VVTETCMDEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPK	485_PAK1_PAK2
PDB file >>>359_PAK1_PAK2	ENST00000530617	ENST00000327134	PAK1	chr11	77047130	PAK2	chr3	196547409	MLLVVTMSNNGLDIQDKPPAPPMRNTSTMIGAGSKDAGTLNHGSKPLPPNPEEKKKKDRFYRSILPGDKTNKKKEKERPEISLPSDFEHT IHVGFDAVTGEFTGMPEQWARLLQTSNITKSEQKKNPQAVLDVLEFYNSKKTSNSQKYMSFTDKSAEDYNSSNALNVKAVSETPAVPPVS EDEDDDDDDATPPPVIAPRPEHTKSVYTRSVIEPLPVTPTRDVATSPISPTENNTTPPDALTRNTEKQKKKPKMSDEEILEKLRSIVSVG DPKKKYTRFEKIGQGASGTVYTAMDVATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTD VVTETCMDEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPK	485
3D view using mol* of 359_PAK1_PAK2

PDB file >>>TKFP_614_PAK1_PAK2	ENST00000530617	ENST00000327134	PAK1	chr11	77047130	PAK2	chr3	196547409	MLLVVTMSNNGLDIQDKPPAPPMRNTSTMIGAGSKDAGTLNHGSKPLPPNPEEKKKKDRFYRSILPGDKTNKKKEKERPEISLPSDFEHT IHVGFDAVTGEFTGMPEQWARLLQTSNITKSEQKKNPQAVLDVLEFYNSKKTSNSQKYMSFTDKSAEDYNSSNALNVKAVSETPAVPPVS EDEDDDDDDATPPPVIAPRPEHTKSVYTRSVIEPLPVTPTRDVATSPISPTENNTTPPDALTRNTEKQKKKPKMSDEEILEKLRSIVSVG DPKKKYTRFEKIGQGASGTVYTAMDVATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTD VVTETCMDEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPK	485_PAK1_PAK2

Top

Comparison of Fusion Protein Isoforms

Superimpose the 3D Structures Among All Fusion Protein Isoforms
* Download the pdb file and open it from the molstar online viewer.

Comparison of the Secondary Structures of Fusion Protein Isoforms

Top

Comparison of Fusion Protein Sequences/Structures with Known Sequences/Structures from PDB

Abstract of the Multiple Sequence Alignment of the Longest Fusion Protein Sequence and Known Sequence from PDB Search Using Fusion Gene Names

Multiple Sequence Alignment of the Longest Fusion Protein Sequence and Known Sequence from PDB Search Using Fusion Gene Names

Superimpose the 3D Structures Between the Longest Fusion Protein and the Longest Known PDB

3D view using mol* of viewer/superimpose_pdbs/PAK1_PAK2_4EQC_superimposed.pdb.html
3D view using mol* of viewer/superimpose_pdbs/PAK1_PAK2_5IME_superimposed.pdb.html

Top

pLDDT score distribution

pLDDT score distribution of the predicted fusion protein structures from AlphaFold2
* AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100.
* The blue color at the bottom marks the best active site residues.

189_PAK1_PAK2.png

Top

Potential Active Site Information

The potential binding sites of these fusion proteins were identified using SiteMap, a module of the Schrodinger suite.

Kinase Fusion AA seq ID in KinaseFusionDB

Site score

Size

Dscore

Volume

Exposure

Enclosure

Contact

Phobic

Philic

Balance

Don/Acc

Residues

Binding site residues of the found PDBs.

PDB accession	AA sequence	Residue position
4EQC	ASP	1
4EQC	PRO	2
4EQC	PHE	3
4EQC	THR	4
4EQC	SER	249
4EQC	ASP	250
4EQC	GLU	251
4EQC	GLU	252
4EQC	ILE	253
4EQC	LEU	254
4EQC	GLU	255
4EQC	LYS	256
4EQC	LEU	257
4EQC	ARG	258
4EQC	SER	259
4EQC	ILE	260
4EQC	VAL	261
4EQC	SER	262
4EQC	VAL	263
4EQC	GLY	264
4EQC	ASP	265
4EQC	PRO	266
4EQC	LYS	267
4EQC	LYS	268
4EQC	LYS	269
4EQC	TYR	270
4EQC	THR	271
4EQC	ARG	272
4EQC	PHE	273
4EQC	GLU	274
4EQC	LYS	275
4EQC	ILE	276
4EQC	GLY	277
4EQC	GLN	278
4EQC	GLY	279
4EQC	ALA	280
4EQC	SER	281
4EQC	GLY	282
4EQC	THR	283
4EQC	VAL	284
4EQC	TYR	285
4EQC	THR	286
4EQC	ALA	287
4EQC	MET	288
4EQC	ASP	289
4EQC	VAL	290
4EQC	ALA	291
4EQC	THR	292
4EQC	GLY	293
4EQC	GLN	294
4EQC	GLU	295
4EQC	VAL	296
4EQC	ALA	297
4EQC	ILE	298
4EQC	ARG	299
4EQC	GLN	300
4EQC	MET	301
4EQC	ASN	302
4EQC	LEU	303
4EQC	GLN	304
4EQC	GLN	305
4EQC	GLN	306
4EQC	PRO	307
4EQC	LYS	308
4EQC	LYS	309
4EQC	GLU	310
4EQC	LEU	311
4EQC	ILE	312
4EQC	ILE	313
4EQC	ASN	314
4EQC	GLU	315
4EQC	ILE	316
4EQC	LEU	317
4EQC	VAL	318
4EQC	MET	319
4EQC	ARG	320
4EQC	GLU	321
4EQC	ASN	322
4EQC	LYS	323
4EQC	ASN	324
4EQC	PRO	325
4EQC	ASN	326
4EQC	ILE	327
4EQC	VAL	328
4EQC	ASN	329
4EQC	TYR	330
4EQC	LEU	331
4EQC	ASP	332
4EQC	SER	333
4EQC	TYR	334
4EQC	LEU	335
4EQC	VAL	336
4EQC	GLY	337
4EQC	ASP	338
4EQC	GLU	339
4EQC	LEU	340
4EQC	TRP	341
4EQC	VAL	342
4EQC	VAL	343
4EQC	MET	344
4EQC	GLU	345
4EQC	TYR	346
4EQC	LEU	347
4EQC	ALA	348
4EQC	GLY	349
4EQC	GLY	350
4EQC	SER	351
4EQC	LEU	352
4EQC	THR	353
4EQC	ASP	354
4EQC	VAL	355
4EQC	VAL	356
4EQC	THR	357
4EQC	GLU	358
4EQC	THR	359
4EQC	CYS	360
4EQC	MET	361
4EQC	ASP	362
4EQC	GLU	363
4EQC	GLY	364
4EQC	GLN	365
4EQC	ILE	366
4EQC	ALA	367
4EQC	ALA	368
4EQC	VAL	369
4EQC	CYS	370
4EQC	ARG	371
4EQC	GLU	372
4EQC	CYS	373
4EQC	LEU	374
4EQC	GLN	375
4EQC	ALA	376
4EQC	LEU	377
4EQC	GLU	378
4EQC	PHE	379
4EQC	LEU	380
4EQC	HIS	381
4EQC	SER	382
4EQC	ASN	383
4EQC	GLN	384
4EQC	VAL	385
4EQC	ILE	386
4EQC	HIS	387
4EQC	ARG	388
4EQC	ASP	389
4EQC	ILE	390
4EQC	LYS	391
4EQC	SER	392
4EQC	ASP	393
4EQC	ASN	394
4EQC	ILE	395
4EQC	LEU	396
4EQC	LEU	397
4EQC	GLY	398
4EQC	MET	399
4EQC	ASP	400
4EQC	GLY	401
4EQC	SER	402
4EQC	VAL	403
4EQC	LYS	404
4EQC	LEU	405
4EQC	THR	406
4EQC	ASP	407
4EQC	PHE	408
4EQC	GLY	409
4EQC	PHE	410
4EQC	CYS	411
4EQC	ALA	412
4EQC	GLN	413
4EQC	ILE	414
4EQC	THR	415
4EQC	PRO	416
4EQC	GLU	417
4EQC	GLN	418
4EQC	SER	419
4EQC	LYS	420
4EQC	ARG	421
4EQC	SER	422
4EQC	MET	424
4EQC	VAL	425
4EQC	GLY	426
4EQC	THR	427
4EQC	PRO	428
4EQC	TYR	429
4EQC	TRP	430
4EQC	MET	431
4EQC	ALA	432
4EQC	PRO	433
4EQC	GLU	434
4EQC	VAL	435
4EQC	VAL	436
4EQC	THR	437
4EQC	ARG	438
4EQC	LYS	439
4EQC	ALA	440
4EQC	TYR	441
4EQC	GLY	442
4EQC	PRO	443
4EQC	LYS	444
4EQC	VAL	445
4EQC	ASP	446
4EQC	ILE	447
4EQC	TRP	448
4EQC	SER	449
4EQC	LEU	450
4EQC	GLY	451
4EQC	ILE	452
4EQC	MET	453
4EQC	ALA	454
4EQC	ILE	455
4EQC	GLU	456
4EQC	MET	457
4EQC	ILE	458
4EQC	GLU	459
4EQC	GLY	460
4EQC	GLU	461
4EQC	PRO	462
4EQC	PRO	463
4EQC	TYR	464
4EQC	LEU	465
4EQC	ASN	466
4EQC	GLU	467
4EQC	ASN	468
4EQC	PRO	469
4EQC	LEU	470
4EQC	ARG	471
4EQC	ALA	472
4EQC	LEU	473
4EQC	TYR	474
4EQC	LEU	475
4EQC	ILE	476
4EQC	ALA	477
4EQC	THR	478
4EQC	ASN	479
4EQC	GLY	480
4EQC	THR	481
4EQC	PRO	482
4EQC	GLU	483
4EQC	LEU	484
4EQC	GLN	485
4EQC	ASN	486
4EQC	PRO	487
4EQC	GLU	488
4EQC	LYS	489
4EQC	LEU	490
4EQC	SER	491
4EQC	ALA	492
4EQC	ILE	493
4EQC	PHE	494
4EQC	ARG	495
4EQC	ASP	496
4EQC	PHE	497
4EQC	LEU	498
4EQC	ASN	499
4EQC	ARG	500
4EQC	CYS	501
4EQC	LEU	502
4EQC	GLU	503
4EQC	MET	504
4EQC	ASP	505
4EQC	VAL	506
4EQC	GLU	507
4EQC	LYS	508
4EQC	ARG	509
4EQC	GLY	510
4EQC	SER	511
4EQC	ALA	512
4EQC	LYS	513
4EQC	GLU	514
4EQC	LEU	515
4EQC	LEU	516
4EQC	GLN	517
4EQC	HIS	518
4EQC	GLN	519
4EQC	PHE	520
4EQC	LEU	521
4EQC	LYS	522
4EQC	ILE	523
4EQC	ALA	524
4EQC	LYS	525
4EQC	PRO	526
4EQC	LEU	527
4EQC	SER	528
4EQC	SER	529
4EQC	LEU	530
4EQC	THR	531
4EQC	PRO	532
4EQC	LEU	533
4EQC	ILE	534
4EQC	ALA	535
4EQC	ALA	536
4EQC	ALA	537
4EQC	LYS	538
4EQC	GLU	539
4EQC	ALA	540
4EQC	THR	541
5IME	GLU	251
5IME	GLU	252
5IME	ILE	253
5IME	LEU	254
5IME	GLU	255
5IME	LYS	256
5IME	LEU	257
5IME	ARG	258
5IME	SER	259
5IME	ILE	260
5IME	VAL	261
5IME	SER	262
5IME	VAL	263
5IME	GLY	264
5IME	ASP	265
5IME	PRO	266
5IME	LYS	267
5IME	LYS	275
5IME	ILE	276
5IME	GLY	277
5IME	GLN	278
5IME	GLY	279
5IME	ALA	280
5IME	SER	281
5IME	GLY	282
5IME	THR	283
5IME	VAL	284
5IME	TYR	285
5IME	THR	286
5IME	ALA	287
5IME	MET	288
5IME	ASP	289
5IME	GLN	294
5IME	GLU	295
5IME	VAL	296
5IME	ALA	297
5IME	ILE	298
5IME	LYS	299
5IME	GLN	300
5IME	MET	301
5IME	ASN	302
5IME	LEU	303
5IME	LYS	309
5IME	GLU	310
5IME	LEU	311
5IME	ILE	312
5IME	ILE	313
5IME	ASN	314
5IME	GLU	315
5IME	ILE	316
5IME	LEU	317
5IME	VAL	318
5IME	MET	319
5IME	ARG	320
5IME	GLU	321
5IME	ASN	322
5IME	LYS	323
5IME	ASN	324
5IME	PRO	325
5IME	ASN	326
5IME	ILE	327
5IME	VAL	328
5IME	ASN	329
5IME	TYR	330
5IME	LEU	331
5IME	ASP	332
5IME	SER	333
5IME	TYR	334
5IME	LEU	335
5IME	VAL	336
5IME	GLY	337
5IME	ASP	338
5IME	GLU	339
5IME	LEU	340
5IME	TRP	341
5IME	VAL	342
5IME	VAL	343
5IME	MET	344
5IME	GLU	345
5IME	TYR	346
5IME	LEU	347
5IME	ALA	348
5IME	GLY	349
5IME	GLY	350
5IME	SER	351
5IME	LEU	352
5IME	THR	353
5IME	ASP	354
5IME	VAL	355
5IME	VAL	356
5IME	THR	357
5IME	GLU	358
5IME	THR	359
5IME	CYS	360
5IME	MET	361
5IME	ASP	362
5IME	GLU	363
5IME	GLY	364
5IME	GLN	365
5IME	ILE	366
5IME	ALA	367
5IME	ALA	368
5IME	VAL	369
5IME	CYS	370
5IME	ARG	371
5IME	GLU	372
5IME	CYS	373
5IME	LEU	374
5IME	GLN	375
5IME	ALA	376
5IME	LEU	377
5IME	GLU	378
5IME	PHE	379
5IME	LEU	380
5IME	HIS	381
5IME	SER	382
5IME	ASN	383
5IME	GLN	384
5IME	VAL	385
5IME	ILE	386
5IME	HIS	387
5IME	ARG	388
5IME	ASN	389
5IME	ILE	390
5IME	LYS	391
5IME	SER	392
5IME	ASP	393
5IME	ASN	394
5IME	ILE	395
5IME	LEU	396
5IME	LEU	397
5IME	GLY	398
5IME	MET	399
5IME	ASP	400
5IME	GLY	401
5IME	SER	402
5IME	VAL	403
5IME	LYS	404
5IME	LEU	405
5IME	THR	406
5IME	ASP	407
5IME	PHE	408
5IME	GLY	409
5IME	PHE	410
5IME	CYS	411
5IME	ALA	412
5IME	GLN	413
5IME	ILE	414
5IME	THR	415
5IME	PRO	416
5IME	GLU	417
5IME	GLN	418
5IME	SER	419
5IME	LYS	420
5IME	ARG	421
5IME	SER	422
5IME	GLU	423
5IME	MET	424
5IME	VAL	425
5IME	GLY	426
5IME	THR	427
5IME	PRO	428
5IME	TYR	429
5IME	TRP	430
5IME	MET	431
5IME	ALA	432
5IME	PRO	433
5IME	GLU	434
5IME	VAL	435
5IME	VAL	436
5IME	THR	437
5IME	ARG	438
5IME	LYS	439
5IME	ALA	440
5IME	TYR	441
5IME	GLY	442
5IME	PRO	443
5IME	LYS	444
5IME	VAL	445
5IME	ASP	446
5IME	ILE	447
5IME	TRP	448
5IME	SER	449
5IME	LEU	450
5IME	GLY	451
5IME	ILE	452
5IME	MET	453
5IME	ALA	454
5IME	ILE	455
5IME	GLU	456
5IME	MET	457
5IME	ILE	458
5IME	GLU	459
5IME	GLY	460
5IME	GLU	461
5IME	PRO	462
5IME	PRO	463
5IME	TYR	464
5IME	LEU	465
5IME	ASN	466
5IME	GLU	467
5IME	ASN	468
5IME	PRO	469
5IME	LEU	470
5IME	ARG	471
5IME	ALA	472
5IME	LEU	473
5IME	TYR	474
5IME	LEU	475
5IME	ILE	476
5IME	ALA	477
5IME	THR	478
5IME	ASN	479
5IME	GLY	480
5IME	THR	481
5IME	PRO	482
5IME	GLU	483
5IME	LEU	484
5IME	GLN	485
5IME	ASN	486
5IME	PRO	487
5IME	GLU	488
5IME	LYS	489
5IME	LEU	490
5IME	SER	491
5IME	ALA	492
5IME	ILE	493
5IME	PHE	494
5IME	ARG	495
5IME	ASP	496
5IME	PHE	497
5IME	LEU	498
5IME	ASN	499
5IME	ARG	500
5IME	CYS	501
5IME	LEU	502
5IME	GLU	503
5IME	MET	504
5IME	ASP	505
5IME	VAL	506
5IME	GLU	507
5IME	LYS	508
5IME	ARG	509
5IME	GLY	510
5IME	SER	511
5IME	ALA	512
5IME	LYS	513
5IME	GLU	514
5IME	LEU	515
5IME	LEU	516
5IME	GLN	517
5IME	HIS	518
5IME	GLN	519
5IME	PHE	520
5IME	LEU	521
5IME	LYS	522
5IME	ILE	523
5IME	ALA	524
5IME	LYS	525
5IME	PRO	526
5IME	LEU	527
5IME	SER	528
5IME	SER	529
5IME	LEU	530
5IME	THR	531
5IME	PRO	532
5IME	LEU	533
5IME	ILE	534
5IME	ALA	535
5IME	ALA	536
5IME	ALA	537
5IME	LYS	538
5IME	GLU	539
5IME	ALA	540
5IME	THR	541
5IME	LYS	542
5IME	ASN	543
5IME	ASN	544
5IME	HIS	545
5IME	GLY	546
5IME	ASP	250
5IME	GLU	251
5IME	GLU	252
5IME	ILE	253
5IME	LEU	254
5IME	GLU	255
5IME	LYS	256
5IME	LEU	257
5IME	ARG	258
5IME	SER	259
5IME	ILE	260
5IME	VAL	261
5IME	SER	262
5IME	VAL	263
5IME	GLY	264
5IME	ASP	265
5IME	PRO	266
5IME	LYS	267
5IME	LYS	268
5IME	LYS	269
5IME	TYR	270
5IME	THR	271
5IME	ARG	272
5IME	PHE	273
5IME	GLU	274
5IME	LYS	275
5IME	ILE	276
5IME	GLY	277
5IME	GLN	278
5IME	GLY	279
5IME	ALA	280
5IME	SER	281
5IME	GLY	282
5IME	THR	283
5IME	VAL	284
5IME	TYR	285
5IME	THR	286
5IME	ALA	287
5IME	MET	288
5IME	ASP	289
5IME	VAL	290
5IME	ALA	291
5IME	THR	292
5IME	GLY	293
5IME	GLN	294
5IME	GLU	295
5IME	VAL	296
5IME	ALA	297
5IME	ILE	298
5IME	LYS	299
5IME	GLN	300
5IME	MET	301
5IME	ASN	302
5IME	PRO	307
5IME	LYS	308
5IME	LYS	309
5IME	GLU	310
5IME	LEU	311
5IME	ILE	312
5IME	ILE	313
5IME	ASN	314
5IME	GLU	315
5IME	ILE	316
5IME	LEU	317
5IME	VAL	318
5IME	MET	319
5IME	ARG	320
5IME	GLU	321
5IME	ASN	322
5IME	LYS	323
5IME	ASN	324
5IME	PRO	325
5IME	ASN	326
5IME	ILE	327
5IME	VAL	328
5IME	ASN	329
5IME	TYR	330
5IME	LEU	331
5IME	ASP	332
5IME	SER	333
5IME	TYR	334
5IME	LEU	335
5IME	VAL	336
5IME	GLY	337
5IME	ASP	338
5IME	GLU	339
5IME	LEU	340
5IME	TRP	341
5IME	VAL	342
5IME	VAL	343
5IME	MET	344
5IME	GLU	345
5IME	TYR	346
5IME	LEU	347
5IME	ALA	348
5IME	GLY	349
5IME	GLY	350
5IME	SER	351
5IME	LEU	352
5IME	THR	353
5IME	ASP	354
5IME	VAL	355
5IME	VAL	356
5IME	THR	357
5IME	GLU	358
5IME	THR	359
5IME	CYS	360
5IME	MET	361
5IME	ASP	362
5IME	GLU	363
5IME	GLY	364
5IME	GLN	365
5IME	ILE	366
5IME	ALA	367
5IME	ALA	368
5IME	VAL	369
5IME	CYS	370
5IME	ARG	371
5IME	GLU	372
5IME	CYS	373
5IME	LEU	374
5IME	GLN	375
5IME	ALA	376
5IME	LEU	377
5IME	GLU	378
5IME	PHE	379
5IME	LEU	380
5IME	HIS	381
5IME	SER	382
5IME	ASN	383
5IME	GLN	384
5IME	VAL	385
5IME	ILE	386
5IME	HIS	387
5IME	ARG	388
5IME	ASN	389
5IME	ILE	390
5IME	LYS	391
5IME	SER	392
5IME	ASP	393
5IME	ASN	394
5IME	ILE	395
5IME	LEU	396
5IME	LEU	397
5IME	GLY	398
5IME	MET	399
5IME	ASP	400
5IME	GLY	401
5IME	SER	402
5IME	VAL	403
5IME	LYS	404
5IME	LEU	405
5IME	THR	406
5IME	ASP	407
5IME	PHE	408
5IME	GLU	417
5IME	GLN	418
5IME	SER	419
5IME	LYS	420
5IME	ARG	421
5IME	SER	422
5IME	GLU	423
5IME	MET	424
5IME	VAL	425
5IME	GLY	426
5IME	THR	427
5IME	PRO	428
5IME	TYR	429
5IME	TRP	430
5IME	MET	431
5IME	ALA	432
5IME	PRO	433
5IME	GLU	434
5IME	VAL	435
5IME	VAL	436
5IME	THR	437
5IME	ARG	438
5IME	LYS	439
5IME	ALA	440
5IME	TYR	441
5IME	GLY	442
5IME	PRO	443
5IME	LYS	444
5IME	VAL	445
5IME	ASP	446
5IME	ILE	447
5IME	TRP	448
5IME	SER	449
5IME	LEU	450
5IME	GLY	451
5IME	ILE	452
5IME	MET	453
5IME	ALA	454
5IME	ILE	455
5IME	GLU	456
5IME	MET	457
5IME	ILE	458
5IME	GLU	459
5IME	GLY	460
5IME	GLU	461
5IME	PRO	462
5IME	PRO	463
5IME	TYR	464
5IME	LEU	465
5IME	ASN	466
5IME	GLU	467
5IME	ASN	468
5IME	PRO	469
5IME	LEU	470
5IME	ARG	471
5IME	ALA	472
5IME	LEU	473
5IME	TYR	474
5IME	LEU	475
5IME	ILE	476
5IME	ALA	477
5IME	THR	478
5IME	ASN	479
5IME	GLY	480
5IME	THR	481
5IME	PRO	482
5IME	GLU	483
5IME	LEU	484
5IME	GLN	485
5IME	ASN	486
5IME	PRO	487
5IME	GLU	488
5IME	LYS	489
5IME	LEU	490
5IME	SER	491
5IME	ALA	492
5IME	ILE	493
5IME	PHE	494
5IME	ARG	495
5IME	ASP	496
5IME	PHE	497
5IME	LEU	498
5IME	ASN	499
5IME	ARG	500
5IME	CYS	501
5IME	LEU	502
5IME	GLU	503
5IME	MET	504
5IME	ASP	505
5IME	VAL	506
5IME	GLU	507
5IME	LYS	508
5IME	ARG	509
5IME	GLY	510
5IME	SER	511
5IME	ALA	512
5IME	LYS	513
5IME	GLU	514
5IME	LEU	515
5IME	LEU	516
5IME	GLN	517
5IME	HIS	518
5IME	GLN	519
5IME	PHE	520
5IME	LEU	521
5IME	LYS	522
5IME	ILE	523
5IME	ALA	524
5IME	LYS	525
5IME	PRO	526
5IME	LEU	527
5IME	SER	528
5IME	SER	529
5IME	LEU	530
5IME	THR	531
5IME	PRO	532
5IME	LEU	533
5IME	ILE	534
5IME	ALA	535
5IME	ALA	536
5IME	ALA	537
5IME	LYS	538
5IME	GLU	539
5IME	ALA	540
5IME	THR	541

Top

Ramachandran Plot of Kinase Fusion Protein Structure

Ramachandran plot of the torsional angles - phi (φ)and psi (ψ) - of the residues (amino acids) contained in this fusion protein peptide.

189_PAK1_PAK2_ramachandran.png

Top

Virtual Screening Results

Distribution of the average docking score across all approved kinase inhibitors.
Distribution of the number of occurrence across all approved kinase inhibitors.

5'-kinase fusion protein case

3'-kinase fusion protein case

Top

Drug information from DrugBank of the top 20 interacting small molecules.
* The detailed information of individual kinase inhibitors are available in the download page.

Fusion gene name info	Drug	Docking score	Glide g score	Glide energy
189_PAK1_PAK2-DOCK_HTVS_1-001	Pralsetinib	-8.47723	-8.56873	-43.7312
189_PAK1_PAK2-DOCK_HTVS_1-001	Acalabrutinib	-7.51242	-7.52652	-38.8977
189_PAK1_PAK2-DOCK_HTVS_1-001	Acalabrutinib	-7.51242	-7.52652	-38.8977
189_PAK1_PAK2-DOCK_HTVS_1-001	Midostaurin	-7.3859699999999995	-7.3859699999999995	-43.0655
189_PAK1_PAK2-DOCK_HTVS_1-001	Neratinib	-6.982480000000001	-7.16838	-60.2967
189_PAK1_PAK2-DOCK_HTVS_1-001	Neratinib	-6.94039	-7.1226899999999995	-59.2826
189_PAK1_PAK2-DOCK_HTVS_1-001	Neratinib	-6.94039	-7.1226899999999995	-59.2826
189_PAK1_PAK2-DOCK_HTVS_1-001	Midostaurin	-6.901860000000001	-6.901860000000001	-39.0018
189_PAK1_PAK2-DOCK_HTVS_1-001	Larotrectinib	-6.82308	-6.82308	-33.4717
189_PAK1_PAK2-DOCK_HTVS_1-001	Lapatinib	-6.742999999999999	-6.8318	-57.4458
189_PAK1_PAK2-DOCK_HTVS_1-001	Lapatinib	-6.71192	-6.80072	-57.7045
189_PAK1_PAK2-DOCK_HTVS_1-001	Larotrectinib	-6.6882399999999995	-6.6882399999999995	-37.8026
189_PAK1_PAK2-DOCK_HTVS_1-001	Encorafenib	-6.600060000000001	-6.9885600000000005	-46.4323
189_PAK1_PAK2-DOCK_HTVS_1-001	Lenvatinib	-6.506530000000001	-6.506530000000001	-41.4377
189_PAK1_PAK2-DOCK_HTVS_1-001	Zanubrutinib	-6.505719999999999	-6.505719999999999	-46.6558
189_PAK1_PAK2-DOCK_HTVS_1-001	Midostaurin	-6.42277	-6.42277	-30.2677
189_PAK1_PAK2-DOCK_HTVS_1-001	Binimetinib	-6.3872	-6.3959	-48.0055
189_PAK1_PAK2-DOCK_HTVS_1-001	Binimetinib	-6.3872	-6.3959	-48.0055
189_PAK1_PAK2-DOCK_HTVS_1-001	Selpercatinib	-6.37918	-6.409680000000001	-41.7146
189_PAK1_PAK2-DOCK_HTVS_1-001	Belumosudil	-6.34066	-6.34836	-45.8752

Top

Kinase-Substrate Information of PAK1_PAK2

Phosphorylation target of the kinase
(phosphosite, 03-17-2024)

Kinase	Kinase UniProt Acc	Kinase species	Substrate	Substrate UniProt Acc	Substrate phosphorylated residues	Substrate phosphorylated sites (+/-7AA)	Domain
PAK1	Q13153	human	FXR1	P51114	S420	sERkDELsDWsLAGE	FXMRP1_C_core
PAK1	Q13153	human	ARPC1B	O15143	T21	HAWNkDRtQIAICPN
PAK1	Q13153	human	GNAZ	P19086	S16	EKEAARRsRRIDRHL	G-alpha
PAK1	Q13153	human	ARHGEF2	Q92974	S886	PVDPRRRsLPAGDAL
PAK1	Q13153	human	MAP3K1	Q13233	S67	RQLRKVRsVELDQLP
PAK1	Q13153	human	TBCB	Q99426	S128	VRsFLKRsKLGRyNE
PAK1	Q13153	human	CRK	P46108	S41	VFLVRDsstsPGDyV	SH2
PAK1	Q13153	human	CTNNB1	P35222	S675	QDykKRLsVELtsSL
PAK1	Q13153	human	GDI2	P50395	T248	LSAIyGGtYMLNkPI	GDI
PAK1	Q13153	human	MICAL1	Q8TDZ2	S817	sPERQRLssLNLtPD
PAK1	Q13153	human	PXN	P49023	S258	tQQQtRIsAssAtRE
PAK1	Q13153	human	GDI2	P50395	S382	PIEQkFVsIsDLLVP	GDI
PAK1	Q13153	human	TBCB	Q99426	S65	GVDDKFYskLDQEDA	Ubiquitin_2
PAK1	Q13153	human	PXN	P49023-2	S272	ELDELMAsLSDFKFM
PAK1	Q13153	human	PLK1	P53350	S49	EVLVDPRsRRRYVRG
PAK1	Q13153	human	H3C1	P68431	S10	tkQtArkstGGkAPr	Histone
PAK1	Q13153	human	PAK1	Q13153	S204	tKsVyTRsVIEPLPV
PAK1	Q13153	human	SNAI1	O95863	S246	QACARTFsRMsLLHK
PAK1	Q13153	human	FLNA	P21333	S2292	FEDRkDGsCGVAYVV	Filamin
PAK1	Q13153	human	ARHGDIA	P52565	S174	kGMLARGsYsIkSRF	Rho_GDI
PAK1	Q13153	human	PCBP1	Q15365	T60	NCPERIItLTGPTNA	KH_1
PAK1	Q13153	human	CTTN	Q14247	S405	KtQtPPVsPAPQPtE
PAK1	Q13153	human	DYNLL1	P63167	S88	VAILLFKsG______	Dynein_light
PAK1	Q13153	human	ARL4A	P40617	S143	QDLRNSLsLSEIEKL	Arf
PAK1	Q13153	human	NLRP3	Q96P20	S198	GKTKTCEsPVSPIKM	FISNA
PAK1	Q13153	human	ARL4D	P49703	S144	QDQPGALsAAEVEkR	Arf
PAK1	Q13153	human	SPEN	Q96T58	T3568	EGVARRMtVETDYCL	SPOC
PAK1	Q13153	human	ARHGEF2	Q92974-2	S885	PVDPRRRsLPAGDAL
PAK1	Q13153	human	AURKA	O14965	S342	QETYKRIsRVEFTFP	Pkinase
PAK1	Q13153	human	STMN1	P16949	S38	sVPEFPLsPPkKkDL	Stathmin
PAK1	Q13153	human	GIT1	Q9Y2X7	S700	PALEPVRsSLRLLNA	GIT1_C
PAK1	Q13153	human	PCBP1	Q15365	T127	IKEIREStGAQVQVA	KH_1
PAK1	Q13153	human	NF2	P35240	S518	DTDMKRLsMEIEKEK	ERM_C
PAK1	Q13153	human	PA2G4	Q9UQ80	T261	QyGLkMktSRAFFsE	Peptidase_M24
PAK1	Q13153	human	RUNX3	Q13761	T209	ERLRMRVtPstPsPr
PAK1	Q13153	human	ARHGDIA	P52565	S101	LEsFKkQsFVLkEGV	Rho_GDI
PAK1	Q13153	human	STMN1	P16949	S16	kELEKrAsGQAFELI	Stathmin
PAK1	Q13153	human	MAP2K1	Q02750	S298	RtPGRPLssyGMDSR	Pkinase
PAK1	Q13153	human	BAD	Q92934	S99	PFrGrsRsAPPNLWA	Bcl-2_BAD
PAK1	Q13153	human	KIF2C	Q99661	S111	kEsLRsRstRMstVS
PAK1	Q13153	human	AURKA	O14965	T288	APSsRRttLCGtLDy	Pkinase
PAK1	Q13153	human	PGM1	P36871	T467	SANDKVYtVEkADNF
PAK1	Q13153	human	PAK1	Q13153	S199	PRPEHtKsVyTRsVI
PAK1	Q13153	human	RAF1	P04049	S339	PRGQRDssyyWEIEA
PAK1	Q13153	human	ILK	Q13418	S246	CPRLRIFsHPNVLPV	PK_Tyr_Ser-Thr
PAK1	Q13153	human	BAD	Q92934	S75	EIRsRHssyPAGtED	Bcl-2_BAD
PAK1	Q13153	human	KIF2C	Q99661	S192	VNsVRRKsCLVkEVE
PAK1	Q13153	human	PGAM1	P18669	S23	WNLENrFsGWyDADL	His_Phos_1
PAK1	Q13153	human	ARHGDIA	P52565	S176	MLARGsYsIkSRFTD	Rho_GDI
PAK1	Q13153	human	ELF3	P78545	S207	GTGASRSsHSSDsGG
PAK1	Q13153	human	MORC2	Q9Y6X9	S739	AtPsRKRsVAVsDEE
PAK1	Q13153	human	CTTN	Q14247	S113	skLskHCsQVDsVrG	HS1_rep
PAK1	Q13153	human	NLRP3	Q96P20	T659	KIEINLStRMDHMVS
PAK1	Q13153	human	BAD	Q92934	S118	GRELRRMsDEFVDsF	Bcl-2_BAD
PAK1	Q13153	human	GIT1	Q9Y2X7	S508	RRDRQAFsMyEPGsA
PAK1	Q13153	human	ITGB3BP	Q13352	S28	SkITRKKsVITysPT	CENP-R
PAK1	Q13153	human	BAD	Q92934	S74	VEIRsRHssyPAGtE	Bcl-2_BAD
PAK1	Q13153	human	NLRP3	Q96P20	S163	ARLGEsVsLNKRYTR	FISNA
PAK1	Q13153	human	MYL9	P24844	S20	KRPQRAtsNVFAMFD
PAK1	Q13153	human	FLNA	P21333	S2152	tRRRRAPsVANVGsH	Filamin
PAK1	Q13153	human	SNAI2	O43623	S251	KNCsKTFsRMsLLHK	zf-C2H2
PAK1	Q13153	human	FLNA	P21333	S2370	AIDAkVHsPsGALEE	Filamin
PAK1	Q13153	human	BRAF	P15056	S446	KtLGRRDssDDWEIP
PAK1	Q13153	human	PGAM1	P18669	S118	QVkIWRRsyDVPPPP	His_Phos_1
PAK1	Q13153	human	CTNNB1	P35222	S552	QDtQRRtsMGGtQQQ
PAK1	Q13153	human	SPEN	Q96T58	S3486	QPAPKQDssPHLTSQ
PAK1	Q13153	human	CTTN	Q14247	S418	tEErLPssPVyEDAA
PAK1	Q13153	human	LIMK1	P53667	T508	PDRKKRYtVVGNPYW	PK_Tyr_Ser-Thr
PAK1	Q13153	human	PAK1	Q13153	S144	sNsQKyMsFtDksAE
PAK1	Q13153	human	RAF1	P04049	S338	RPRGQRDssyyWEIE
PAK1	Q13153	human	PREX2	Q70Z35	S1107	DTISNRDsYSDCNSN
PAK1	Q13153	human	ILK	Q13418	T173	DTFWkGttRTRPRNG
PAK1	Q13153	human	CTBP1	Q13363	S158	REGTRVQsVEQIREV	2-Hacid_dh_C; 2-Hacid_dh
PAK1	Q13153	human	PAK1	Q13153	T423	PEQSkRstMVGtPYW	Pkinase
PAK1	Q13153	human	MICAL1	Q8TDZ2	S960	ELALRRQssSPEQQK	bMERB_dom
PAK1	Q13153	human	HACE1	Q8IYU2	S385	LMKNKRDsTEITsIL
PAK1	Q13153	human	ESR1	P03372	S305	IkRSkkNsLALSLtA
PAK1	Q13153	human	MYLK	Q15746	S1772	SGLsGRKsstGsPts
PAK1	Q13153	human	BAD	Q92934	S134	KGLPRPKsAGtAtQM	Bcl-2_BAD
PAK1	Q13153	human	VIM	P08670	S56	srsLyAssPGGVyAt	Filament_head
PAK1	Q13153	human	ATG5	Q9H1Y0	T101	SALPWNItVHFKSFP	APG5
PAK2	Q13177	human	MYC	P01106	S388	RRNELkRsFFALRDQ	HLH
PAK2	Q13177	human	ARHGAP15	Q53QZ3	S292	kVCERENsTVPWFVk
PAK2	Q13177	human	H4C1	P62805	S47	RGGVKrIsGLIyEEt	CENP-T_C
PAK2	Q13177	human	JUN	P05412	T2	______MtAKMETtF
PAK2	Q13177	human	CALD1	Q05682	S744	GLKVGVSsRINEWLT	Caldesmon
PAK2	Q13177	human	JUN	P05412	T286	RLEEKVKtLKAQNSE	bZIP_1
PAK2	Q13177	human	MYC	P01106	T373	EENVkRRtHNVLERQ	HLH
PAK2	Q13177	human	MICAL1	Q8TDZ2	S817	sPERQRLssLNLtPD
PAK2	Q13177	human	SORT1	Q99523	S793	RFLVHRYsVLQQHAE
PAK2	Q13177	human	CASP7	P55210	S239	WRsPGRGsWFVQALC	Peptidase_C14
PAK2	Q13177	human	ABL1	P00519	S619	PtPPKRsssFREMDG
PAK2	Q13177	human	PAK2	Q13177	S192	PRPDHTksIytRsVI
PAK2	Q13177	human	PAK2	Q13177	S141	tVkQKyLsFtPPEkd
PAK2	Q13177	human	SMAD2	Q15796	S467	sVRCssMs_______
PAK2	Q13177	human	NF2	P35240	S518	DTDMKRLsMEIEKEK	ERM_C
PAK2	Q13177	human	SMAD2	Q15796	S417	RMCTIRMsFVkGWGA	MH2
PAK2	Q13177	human	EIF4G1	Q04637	S895	RDIARRRsLGNIkFI	MIF4G
PAK2	Q13177	human	ARHGAP15	Q53QZ3	S4	____MQKsTNsDTSV
PAK2	Q13177	human	ARHGAP15	Q53QZ3	S43	DRLsQsksMILTDVG
PAK2	Q13177	human	PAK2	Q13177	T402	PEQSkRstMVGtPYW	Pkinase
PAK2	Q13177	human	JUN	P05412	T8	MtAKMETtFYDDALN	Jun
PAK2	Q13177	human	SMAD2	Q15796	S465	sPsVRCssMs_____
PAK2	Q13177	human	MYC	P01106	T415	VVILKkAtAYILsVQ	HLH
PAK2	Q13177	human	PXN	P49023	S272	ELDELMAsLsDFkIQ
PAK2	Q13177	human	CASP7	P55210	S30	DAKPDRssFVPsLFs
PAK2	Q13177	human	CALD1	Q05682	S714	EGVRNIksMWEkGNV	Caldesmon
PAK2	Q13177	human	ARHGAP15	Q53QZ3	S41	HHDRLsQsksMILTD
PAK2	Q13177	human	MAPK6	Q16659	S189	ySHKGHLsEGLVTkW	Pkinase
PAK2	Q13177	human	PXN	P49023	S274	DELMAsLsDFkIQGL
PAK2	Q13177	human	PAK2	Q13177	S197	TksIytRsVIDPVPA
PAK2	Q13177	human	CASP7	P55210	T173	FRGDRCktLLEkPKL	Peptidase_C14
PAK2	Q13177	human	CTNNB1	P35222	S552	QDtQRRtsMGGtQQQ
PAK2	Q13177	human	SMAD2	Q15796	S464	GsPsVRCssMs____
PAK2	Q13177	human	JUN	P05412	T89	QSSNGHItTtPtPtQ	Jun
PAK2	Q13177	human	PREX2	Q70Z35	S1107	DTISNRDsYSDCNSN
PAK2	Q13177	human	RAF1	P04049	S338	RPRGQRDssyyWEIE
PAK2	Q13177	human	MICAL1	Q8TDZ2	S960	ELALRRQssSPEQQK	bMERB_dom
PAK2	Q13177	human	HACE1	Q8IYU2	S385	LMKNKRDsTEITsIL
PAK2	Q13177	human	SLC25A5	P05141	T107	LGGVDkRtQFWLyFA
PAK2	Q13177	human	JUN	P05412	T93	GHItTtPtPtQFLCP	Jun
PAK2	Q13177	human	ABL1	P00519	S618	APtPPKRsssFREMD

Biological Network Integration of This Kinase and Substrates
(GeneMANIA website)

Enriched GO biological processes of the phosphorylation target genes of the kinase

Kinase	GOID	GO term	P.adjust
PAK1	ID	Description	0.00e+00
PAK1	GO:0051017	actin filament bundle assembly	7.15e-06
PAK1	GO:0061572	actin filament bundle organization	7.15e-06
PAK1	GO:0032233	positive regulation of actin filament bundle assembly	7.15e-06
PAK1	GO:0032231	regulation of actin filament bundle assembly	7.15e-06
PAK1	GO:1902905	positive regulation of supramolecular fiber organization	8.29e-06
PAK1	GO:0051495	positive regulation of cytoskeleton organization	9.71e-06
PAK1	GO:0007015	actin filament organization	9.71e-06
PAK1	GO:1902903	regulation of supramolecular fiber organization	1.82e-05
PAK1	GO:0051492	regulation of stress fiber assembly	4.26e-05
PAK1	GO:0051496	positive regulation of stress fiber assembly	4.66e-05
PAK1	GO:0032956	regulation of actin cytoskeleton organization	4.66e-05
PAK1	GO:0110020	regulation of actomyosin structure organization	6.18e-05
PAK1	GO:0030038	contractile actin filament bundle assembly	6.98e-05
PAK1	GO:0043149	stress fiber assembly	6.98e-05
PAK1	GO:0007264	small GTPase mediated signal transduction	7.90e-05
PAK1	GO:0110053	regulation of actin filament organization	7.90e-05
PAK1	GO:0032970	regulation of actin filament-based process	8.07e-05
PAK1	GO:0031032	actomyosin structure organization	1.50e-04
PAK1	GO:0010720	positive regulation of cell development	2.67e-04
PAK1	GO:0007265	Ras protein signal transduction	3.33e-04
PAK1	GO:0031589	cell-substrate adhesion	4.35e-04
PAK1	GO:1900026	positive regulation of substrate adhesion-dependent cell spreading	4.38e-04
PAK1	GO:0022411	cellular component disassembly	5.51e-04
PAK1	GO:1903034	regulation of response to wounding	5.70e-04
PAK1	GO:0034446	substrate adhesion-dependent cell spreading	5.74e-04
PAK1	GO:0048538	thymus development	6.92e-04
PAK1	GO:0046578	regulation of Ras protein signal transduction	6.98e-04
PAK1	GO:0071470	cellular response to osmotic stress	8.16e-04
PAK1	GO:0051056	regulation of small GTPase mediated signal transduction	9.24e-04
PAK1	GO:1900024	regulation of substrate adhesion-dependent cell spreading	1.44e-03
PAK1	GO:0048732	gland development	1.44e-03
PAK1	GO:0031109	microtubule polymerization or depolymerization	1.86e-03
PAK1	GO:0007266	Rho protein signal transduction	2.00e-03
PAK1	GO:0061311	cell surface receptor signaling pathway involved in heart development	2.67e-03
PAK1	GO:2001234	negative regulation of apoptotic signaling pathway	2.67e-03
PAK1	GO:0044342	type B pancreatic cell proliferation	3.17e-03
PAK1	GO:0032886	regulation of microtubule-based process	3.47e-03
PAK1	GO:0006970	response to osmotic stress	3.47e-03
PAK1	GO:0039694	viral RNA genome replication	3.47e-03
PAK1	GO:0048679	regulation of axon regeneration	3.47e-03
PAK1	GO:0070507	regulation of microtubule cytoskeleton organization	3.47e-03
PAK1	GO:0035023	regulation of Rho protein signal transduction	3.47e-03
PAK1	GO:0030878	thyroid gland development	3.60e-03
PAK1	GO:0050767	regulation of neurogenesis	3.60e-03
PAK1	GO:0061351	neural precursor cell proliferation	3.66e-03
PAK1	GO:0070570	regulation of neuron projection regeneration	3.72e-03
PAK1	GO:2001233	regulation of apoptotic signaling pathway	3.83e-03
PAK1	GO:0031110	regulation of microtubule polymerization or depolymerization	5.14e-03
PAK1	GO:0042060	wound healing	5.36e-03

Top

Related Drugs to PAK1_PAK2

Drugs used for this fusion-positive patient.
(Manual curation of PubMed, 04-30-2022 + MyCancerGenome)

Hgene

Tgene

Drug

Source

PMID

Distribution of the number of studies mentioning PAK1-PAK2 and kinase inhibitors the PubMed Abstract (04-01-2024)

Fusion gene - drug pair 1

Fusion gene - drug pair 2

PMID

Publication date

DOI

Study title

Top

Related Diseases to PAK1_PAK2

Diseases that have this fusion gene.
(Manual curation of PubMed, 04-30-2022 + MyCancerGenome)

Hgene

Tgene

Disease

Source

PMID

Related diseases from the literature mentioned this fusion gene and drug.
(PubMed, 04-01-2024)

MeSH ID

MeSH term

Diseases associated with fusion partners.
(DisGeNet 4.0)

Partner

Gene

Disease ID

Disease name

# pubmeds

Source

Top

Clinical Trials of the Found Drugs/Small Molecules

Statistics of the Clinical Trials of the Found Kinase Inibitors from clinicaltrials.gov (06-17-2024)

Clinical Trials from clinicaltrials.gov (06-17-2024)

Fusion Gene

Kinase Inhibitor

NCT ID

Study Status

Phases

Disease

# Enrolment

Date