UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
|
Kinase Fusion Gene:PAK2_DLG1 |
Kinase Fusion Protein Summary |
Kinase Fusion gene summary |
Kinase Fusion partner gene information | Kinase Fusion gene name: PAK2_DLG1 | KinaseFusionDB ID: KFG4436 | FusionGDB2.0 ID: KFG4436 | Hgene | Tgene | Gene symbol | PAK2 | DLG1 | Gene ID | 5586 | 1739 | |
Gene name | protein kinase N2 | discs large MAGUK scaffold protein 1 | ||||||||||
Synonyms | PAK2|PRK2|PRKCL2|PRO2042|Pak-2|STK7 | DLGH1|SAP-97|SAP97|hdlg | ||||||||||
Cytomap | 1p22.2 | 3q29 | ||||||||||
Type of gene | protein-coding | protein-coding | ||||||||||
Description | serine/threonine-protein kinase N2PKN gammacardiolipin-activated protein kinase Pak2protein kinase C-like 2protein-kinase C-related kinase 2 | disks large homolog 1dJ1061C18.1.1discs large homolog 1, scribble cell polarity complex componentpresynaptic protein SAP97synapse-associated protein 97 | ||||||||||
Modification date | 20240323 | 20240411 | ||||||||||
UniProtAcc | Q13177 | Q12959 | ||||||||||
Ensembl transtripts involved in fusion gene | ENST ids | ENST00000327134, | ENST00000314062, ENST00000346964, ENST00000357674, ENST00000392382, ENST00000419354, ENST00000422288, ENST00000443183, ENST00000448528, ENST00000450955, ENST00000452595, ENST00000485409, | |||||||||
Context (manual curation of fusion genes in KinaseFusionDB) | PubMed: PAK2 [Title/Abstract] AND DLG1 [Title/Abstract] AND fusion [Title/Abstract] | |||||||||||
Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) | DLG1(197009550)-PAK2(196534653), # samples:3 PAK2(196532254)-DLG1(196876667), # samples:3 |
Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
Partner | Gene | GO ID | GO term | PubMed ID |
Hgene | PAK2 | GO:0006468 | protein phosphorylation | 17332740 |
Hgene | PAK2 | GO:0010631 | epithelial cell migration | 21754995 |
Tgene | DLG1 | GO:0001935 | endothelial cell proliferation | 14699157 |
Tgene | DLG1 | GO:0007015 | actin filament organization | 14699157 |
Tgene | DLG1 | GO:0030866 | cortical actin cytoskeleton organization | 14699157 |
Tgene | DLG1 | GO:0042391 | regulation of membrane potential | 12970345 |
Tgene | DLG1 | GO:0043268 | positive regulation of potassium ion transport | 12970345 |
Tgene | DLG1 | GO:0070830 | bicellular tight junction assembly | 17332497 |
Tgene | DLG1 | GO:0098609 | cell-cell adhesion | 14699157 |
Tgene | DLG1 | GO:1902473 | regulation of protein localization to synapse | 23676497 |
Tgene | DLG1 | GO:1903078 | positive regulation of protein localization to plasma membrane | 12970345 |
Kinase Fusion gene breakpoints across PAK2 (5'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Kinase Fusion gene breakpoints across DLG1 (3'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Top |
Kinase Fusion Gene Sample Information |
Kinase Fusion gene information. |
Kinase Fusion gene information from four resources (ChiTars 5.0, ChimerDB 4.0, COSMIC, and CCLE) * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
Source | Sample | Hgene | Hchr | Hbp | Tgene | Tchr | Tbp |
ChimerDB4 | TCGA-25-1328-01A | PAK2 | chr3 | 196532254 | DLG1 | chr3 | 196876667 |
ChimerDB4 | TCGA-25-1328-01A | PAK2 | chr3 | 196532254 | DLG1 | chr3 | 196888609 |
ChimerDB4 | TCGA-25-1328-01A | PAK2 | chr3 | 196532254 | DLG1 | chr3 | 196869639 |
ChimerDB4 | TCGA-JY-A6F8-01A | PAK2 | chr3 | 196467028 | DLG1 | chr3 | 196921460 |
Top |
Kinase Fusion ORF Analysis |
Kinase Fusion information from ORFfinder translation from full-length transcript sequence from KinaseFusionDB. |
Henst | Tenst | Hgene | Hchr | Hbp | Tgene | Tchr | Tbp | Seq length (transcript) | Seq length (amino acids) |
ENST00000327134 | ENST00000357674 | PAK2 | chr3 | 196532254 | DLG1 | chr3 | 196876667 | 5052 | 888 |
ENST00000327134 | ENST00000357674 | PAK2 | chr3 | 196532254 | DLG1 | chr3 | 196869639 | 4998 | 870 |
Top |
Kinase Fusion Amino Acid Sequences |
For individual full-length fusion transcript sequence from KinaseFusionDB, we ran ORFfinder and chose the longest ORF among the all predicted ones. |
>Henst_Tenst_Hgene_Hchr_Hbp_Tgene_Tchr_Tbp_length(fusion AA)_AAseq >ENST00000327134_ENST00000357674_PAK2_chr3_196532254_DLG1_chr3_196876667_length(amino acids)=888 MSDNGELEDKPPAPPVRMSSTIFSTGGKDPLSANHSLKPLPSVPEEKKPRHKIISIFSGTEKGSKKKEKERPEISPPSDFEHTIHVGFDA VTGEFTGMPEQWARLLQTSNITKLEQKKNPQAVLDVLKFYDSNTVKQKYLSFTPPEKDGFPSGTPAANPPPVLVNTDSLETPTYVNGTDA DYEYEEITLERGNSGLGFSIAGGTDNPHIGDDSSIFITKIITGGAAAQDGRLRVNDCILRVNEVDVRDVTHSKAVEALKEAGSIVRLYVK RRKPVSEKIMEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGKLQIGDKLLAVNNVCLEEVTHEEAVTALKNTSDFV YLKVAKPTSMYMNDGYAPPDITNSSSQPVDNHVSPSSFLGQTPASPARYSPVSKAVLGDDEITREPRKVVLHRGSTGLGFNIVGGEDGEG IFISFILAGGPADLSGELRKGDRIISVNSVDLRAASHEQAAAALKNAGQAVTIVAQYRPEEYSRFEAKIHDLREQMMNSSISSGSGSLRT SQKRSLYVRALFDYDKTKDSGLPSQGLNFKFGDILHVINASDDEWWQARQVTPDGESDEVGVIPSKRRVEKKERARLKTVKFNSKTRDKG QSFNDKRKKNLFSRKFPFYKNKDQSEQETSDADQHVTSNASDSESSYRGQEEYVLSYEPVNQQEVNYTRPVIILGPMKDRINDDLISEFP DKFGSCVPHTTRPKRDYEVDGRDYHFVTSREQMEKDIQEHKFIEAGQYNNHLYGTSVQSVREVAEKGKHCILDVSGNAIKRLQIAQLYPI -------------------------------------------------------------- >ENST00000327134_ENST00000357674_PAK2_chr3_196532254_DLG1_chr3_196869639_length(amino acids)=870 MSDNGELEDKPPAPPVRMSSTIFSTGGKDPLSANHSLKPLPSVPEEKKPRHKIISIFSGTEKGSKKKEKERPEISPPSDFEHTIHVGFDA VTGEFTGMPEQWARLLQTSNITKLEQKKNPQAVLDVLKFYDSNTVKQKYLSFTPPEKDGFPSGTPAVNGTDADYEYEEITLERGNSGLGF SIAGGTDNPHIGDDSSIFITKIITGGAAAQDGRLRVNDCILRVNEVDVRDVTHSKAVEALKEAGSIVRLYVKRRKPVSEKIMEIKLIKGP KGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGKLQIGDKLLAVNNVCLEEVTHEEAVTALKNTSDFVYLKVAKPTSMYMNDGYAP PDITNSSSQPVDNHVSPSSFLGQTPASPARYSPVSKAVLGDDEITREPRKVVLHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSGEL RKGDRIISVNSVDLRAASHEQAAAALKNAGQAVTIVAQYRPEEYSRFEAKIHDLREQMMNSSISSGSGSLRTSQKRSLYVRALFDYDKTK DSGLPSQGLNFKFGDILHVINASDDEWWQARQVTPDGESDEVGVIPSKRRVEKKERARLKTVKFNSKTRDKGQSFNDKRKKNLFSRKFPF YKNKDQSEQETSDADQHVTSNASDSESSYRGQEEYVLSYEPVNQQEVNYTRPVIILGPMKDRINDDLISEFPDKFGSCVPHTTRPKRDYE VDGRDYHFVTSREQMEKDIQEHKFIEAGQYNNHLYGTSVQSVREVAEKGKHCILDVSGNAIKRLQIAQLYPISIFIKPKSMENIMEMNKR -------------------------------------------------------------- |
Multiple Sequence Alignment of All Fusion Protein Isoforms |
Top |
Kinase Fusion Protein Functional Features |
Four levels of functional features of fusion genes Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr3:197009550/chr3:196534653) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
Main function of each fusion partner protein. (from UniProt) |
Hgene | Tgene |
PAK2 | DLG1 |
FUNCTION: Serine/threonine protein kinase that plays a role in a variety of different signaling pathways including cytoskeleton regulation, cell motility, cell cycle progression, apoptosis or proliferation (PubMed:7744004, PubMed:19273597, PubMed:19923322, PubMed:9171063, PubMed:12853446, PubMed:16617111, PubMed:33693784). Acts as a downstream effector of the small GTPases CDC42 and RAC1 (PubMed:7744004). Activation by the binding of active CDC42 and RAC1 results in a conformational change and a subsequent autophosphorylation on several serine and/or threonine residues (PubMed:7744004). Full-length PAK2 stimulates cell survival and cell growth (PubMed:7744004). Phosphorylates MAPK4 and MAPK6 and activates the downstream target MAPKAPK5, a regulator of F-actin polymerization and cell migration (PubMed:21317288). Phosphorylates JUN and plays an important role in EGF-induced cell proliferation (PubMed:21177766). Phosphorylates many other substrates including histone H4 to promote assembly of H3.3 and H4 into nucleosomes, BAD, ribosomal protein S6, or MBP (PubMed:21724829). Phosphorylates CASP7, thereby preventing its activity (PubMed:21555521, PubMed:27889207). Additionally, associates with ARHGEF7 and GIT1 to perform kinase-independent functions such as spindle orientation control during mitosis (PubMed:19273597, PubMed:19923322). On the other hand, apoptotic stimuli such as DNA damage lead to caspase-mediated cleavage of PAK2, generating PAK-2p34, an active p34 fragment that translocates to the nucleus and promotes cellular apoptosis involving the JNK signaling pathway (PubMed:9171063, PubMed:12853446, PubMed:16617111). Caspase-activated PAK2 phosphorylates MKNK1 and reduces cellular translation (PubMed:15234964). {ECO:0000269|PubMed:12853446, ECO:0000269|PubMed:15234964, ECO:0000269|PubMed:16617111, ECO:0000269|PubMed:19273597, ECO:0000269|PubMed:19923322, ECO:0000269|PubMed:21177766, ECO:0000269|PubMed:21317288, ECO:0000269|PubMed:21555521, ECO:0000269|PubMed:21724829, ECO:0000269|PubMed:27889207, ECO:0000269|PubMed:33693784, ECO:0000269|PubMed:7744004, ECO:0000269|PubMed:9171063}. | FUNCTION: Essential multidomain scaffolding protein required for normal development (By similarity). Recruits channels, receptors and signaling molecules to discrete plasma membrane domains in polarized cells. May play a role in adherens junction assembly, signal transduction, cell proliferation, synaptogenesis and lymphocyte activation. Regulates the excitability of cardiac myocytes by modulating the functional expression of Kv4 channels. Functional regulator of Kv1.5 channel. During long-term depression in hippocampal neurons, it recruits ADAM10 to the plasma membrane (PubMed:23676497). {ECO:0000250, ECO:0000269|PubMed:10656683, ECO:0000269|PubMed:12445884, ECO:0000269|PubMed:14699157, ECO:0000269|PubMed:15263016, ECO:0000269|PubMed:19213956, ECO:0000269|PubMed:20605917, ECO:0000269|PubMed:23676497}. |
Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
- Retained domain in the 5'-partner of fusion protein (protein functional feature from UniProt). |
Partner | Hgeneene | Hbp | Tgeneene | Tbp | ENST | BPexon | TotalExon | Protein feature loci | BPloci | TotalLen | Feature | Note |
Hgene | PAK2 | 196532254 | DLG1 | 196869639 | ENST00000327134 | 5 | 15 | 74_87 | 1561 | 525 | Domain | Note=CRIB;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00057 |
Hgene | PAK2 | 196532254 | DLG1 | 196876667 | ENST00000327134 | 5 | 15 | 74_87 | 1561 | 525 | Domain | Note=CRIB;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00057 |
- Retained domain in the 3'-partner of fusion protein (protein functional feature from UniProt). |
Partner | Hgeneene | Hbp | Tgeneene | Tbp | ENST | BPexon | TotalExon | Protein feature loci | BPloci | TotalLen | Feature | Note |
Top |
Kinase Fusion Protein Structures |
CIF files of the predicted kinase fusion proteins * Here we show the 3D structure of the fusion proteins using Mol*. AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Model confidence is shown from the pLDDT values per residue. pLDDT corresponds to the model’s prediction of its score on the local Distance Difference Test. It is a measure of local accuracy (from AlphfaFold website). To color code individual residues, we transformed individual PDB files into CIF format. |
Kinase Fusion protein CIF link (fusion AA seq ID in KinaseFusionDB) | Henst | Tenst | Hgene | Hchr | Hbp | Tgene | Tchr | Tbp | AA seq | Len(AA seq) |
PDB file >>>190_PAK2_DLG1 | ENST00000327134 | ENST00000357674 | PAK2 | chr3 | 196532254 | DLG1 | chr3 | 196869639 | MSDNGELEDKPPAPPVRMSSTIFSTGGKDPLSANHSLKPLPSVPEEKKPRHKIISIFSGTEKGSKKKEKERPEISPPSDFEHTIHVGFDA VTGEFTGMPEQWARLLQTSNITKLEQKKNPQAVLDVLKFYDSNTVKQKYLSFTPPEKDGFPSGTPAVNGTDADYEYEEITLERGNSGLGF SIAGGTDNPHIGDDSSIFITKIITGGAAAQDGRLRVNDCILRVNEVDVRDVTHSKAVEALKEAGSIVRLYVKRRKPVSEKIMEIKLIKGP KGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGKLQIGDKLLAVNNVCLEEVTHEEAVTALKNTSDFVYLKVAKPTSMYMNDGYAP PDITNSSSQPVDNHVSPSSFLGQTPASPARYSPVSKAVLGDDEITREPRKVVLHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSGEL RKGDRIISVNSVDLRAASHEQAAAALKNAGQAVTIVAQYRPEEYSRFEAKIHDLREQMMNSSISSGSGSLRTSQKRSLYVRALFDYDKTK DSGLPSQGLNFKFGDILHVINASDDEWWQARQVTPDGESDEVGVIPSKRRVEKKERARLKTVKFNSKTRDKGQSFNDKRKKNLFSRKFPF YKNKDQSEQETSDADQHVTSNASDSESSYRGQEEYVLSYEPVNQQEVNYTRPVIILGPMKDRINDDLISEFPDKFGSCVPHTTRPKRDYE VDGRDYHFVTSREQMEKDIQEHKFIEAGQYNNHLYGTSVQSVREVAEKGKHCILDVSGNAIKRLQIAQLYPISIFIKPKSMENIMEMNKR | 870 |
3D view using mol* of 190_PAK2_DLG1 | ||||||||||
PDB file >>>HKFP_276_PAK2_DLG1 | ENST00000327134 | ENST00000357674 | PAK2 | chr3 | 196532254 | DLG1 | chr3 | 196876667 | MSDNGELEDKPPAPPVRMSSTIFSTGGKDPLSANHSLKPLPSVPEEKKPRHKIISIFSGTEKGSKKKEKERPEISPPSDFEHTIHVGFDA VTGEFTGMPEQWARLLQTSNITKLEQKKNPQAVLDVLKFYDSNTVKQKYLSFTPPEKDGFPSGTPAANPPPVLVNTDSLETPTYVNGTDA DYEYEEITLERGNSGLGFSIAGGTDNPHIGDDSSIFITKIITGGAAAQDGRLRVNDCILRVNEVDVRDVTHSKAVEALKEAGSIVRLYVK RRKPVSEKIMEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGKLQIGDKLLAVNNVCLEEVTHEEAVTALKNTSDFV YLKVAKPTSMYMNDGYAPPDITNSSSQPVDNHVSPSSFLGQTPASPARYSPVSKAVLGDDEITREPRKVVLHRGSTGLGFNIVGGEDGEG IFISFILAGGPADLSGELRKGDRIISVNSVDLRAASHEQAAAALKNAGQAVTIVAQYRPEEYSRFEAKIHDLREQMMNSSISSGSGSLRT SQKRSLYVRALFDYDKTKDSGLPSQGLNFKFGDILHVINASDDEWWQARQVTPDGESDEVGVIPSKRRVEKKERARLKTVKFNSKTRDKG QSFNDKRKKNLFSRKFPFYKNKDQSEQETSDADQHVTSNASDSESSYRGQEEYVLSYEPVNQQEVNYTRPVIILGPMKDRINDDLISEFP DKFGSCVPHTTRPKRDYEVDGRDYHFVTSREQMEKDIQEHKFIEAGQYNNHLYGTSVQSVREVAEKGKHCILDVSGNAIKRLQIAQLYPI | 888_PAK2_DLG1 |
PDB file >>>HKFP_277_PAK2_DLG1 | ENST00000327134 | ENST00000357674 | PAK2 | chr3 | 196532254 | DLG1 | chr3 | 196869639 | MSDNGELEDKPPAPPVRMSSTIFSTGGKDPLSANHSLKPLPSVPEEKKPRHKIISIFSGTEKGSKKKEKERPEISPPSDFEHTIHVGFDA VTGEFTGMPEQWARLLQTSNITKLEQKKNPQAVLDVLKFYDSNTVKQKYLSFTPPEKDGFPSGTPAVNGTDADYEYEEITLERGNSGLGF SIAGGTDNPHIGDDSSIFITKIITGGAAAQDGRLRVNDCILRVNEVDVRDVTHSKAVEALKEAGSIVRLYVKRRKPVSEKIMEIKLIKGP KGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGKLQIGDKLLAVNNVCLEEVTHEEAVTALKNTSDFVYLKVAKPTSMYMNDGYAP PDITNSSSQPVDNHVSPSSFLGQTPASPARYSPVSKAVLGDDEITREPRKVVLHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSGEL RKGDRIISVNSVDLRAASHEQAAAALKNAGQAVTIVAQYRPEEYSRFEAKIHDLREQMMNSSISSGSGSLRTSQKRSLYVRALFDYDKTK DSGLPSQGLNFKFGDILHVINASDDEWWQARQVTPDGESDEVGVIPSKRRVEKKERARLKTVKFNSKTRDKGQSFNDKRKKNLFSRKFPF YKNKDQSEQETSDADQHVTSNASDSESSYRGQEEYVLSYEPVNQQEVNYTRPVIILGPMKDRINDDLISEFPDKFGSCVPHTTRPKRDYE VDGRDYHFVTSREQMEKDIQEHKFIEAGQYNNHLYGTSVQSVREVAEKGKHCILDVSGNAIKRLQIAQLYPISIFIKPKSMENIMEMNKR | 870_PAK2_DLG1 |
3D view using mol* of HKFP_277_PAK2_DLG1 | ||||||||||
Top |
Comparison of Fusion Protein Isoforms |
Superimpose the 3D Structures Among All Fusion Protein Isoforms * Download the pdb file and open it from the molstar online viewer. |
3D view using mol* of viewer/superimpose_isoforms/HKFP_276_PAK2_DLG1_vs_HKFP_277_PAK2_DLG1_superimposed.pdb.html |
Comparison of the Secondary Structures of Fusion Protein Isoforms |
./secondary_str/HKFP_277_PAK2_DLG1_vs_HKFP_276_PAK2_DLG1.png |
Top |
Comparison of Fusion Protein Sequences/Structures with Known Sequences/Structures from PDB |
Top |
pLDDT score distribution |
pLDDT score distribution of the predicted fusion protein structures from AlphaFold2 * AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. * The blue color at the bottom marks the best active site residues. |
190_PAK2_DLG1.png |
190_PAK2_DLG1.png |
HKFP_277_PAK2_DLG1.png |
Top |
Potential Active Site Information |
The potential binding sites of these fusion proteins were identified using SiteMap, a module of the Schrodinger suite. |
Kinase Fusion AA seq ID in KinaseFusionDB | Site score | Size | Dscore | Volume | Exposure | Enclosure | Contact | Phobic | Philic | Balance | Don/Acc | Residues |
HKFP_277_PAK2_DLG1 | 1.032 | 409 | 1.063 | 961.772 | 0.505 | 0.719 | 0.962 | 0.768 | 0.947 | 0.811 | 1.148 | Chain A: 11,12,13,14,15,16,17,18,19,20,37,38,39,40 ,41,42,43,44,296,691,694,695,698,699,706,707,708,7 09,710,714,717,719,720,724,725,726,727,736,739,740 ,742,745,746,747,748,749,750,751,753,755,756,757,7 61,764,765,768,773,774,775,776,777,779,780,782,783 ,786 |
Top |
Ramachandran Plot of Kinase Fusion Protein Structure |
Ramachandran plot of the torsional angles - phi (φ)and psi (ψ) - of the residues (amino acids) contained in this fusion protein peptide. |
190_PAK2_DLG1_ramachandran.png |
HKFP_277_PAK2_DLG1_ramachandran.png |
Top |
Virtual Screening Results |
Distribution of the average docking score across all approved kinase inhibitors. Distribution of the number of occurrence across all approved kinase inhibitors. |
5'-kinase fusion protein case |
3'-kinase fusion protein case |
Top |
Drug information from DrugBank of the top 20 interacting small molecules. * The detailed information of individual kinase inhibitors are available in the download page. |
Fusion gene name info | Drug | Docking score | Glide g score | Glide energy |
HKFP_277_PAK2_DLG1_vsw_9-DOCK_HTVS_1-001 | Ripretinib | -7.70552 | -7.71252 | -50.2643 |
HKFP_277_PAK2_DLG1_vsw_9-DOCK_HTVS_1-001 | Ripretinib | -7.70552 | -7.71252 | -50.2643 |
HKFP_277_PAK2_DLG1_vsw_9-DOCK_HTVS_1-001 | Axitinib | -6.926069999999998 | -6.92927 | -50.8995 |
HKFP_277_PAK2_DLG1_vsw_9-DOCK_HTVS_1-001 | Lapatinib | -6.81767 | -6.90647 | -58.4623 |
HKFP_277_PAK2_DLG1_vsw_9-DOCK_HTVS_1-001 | Acalabrutinib | -6.53604 | -6.55014 | -51.4479 |
HKFP_277_PAK2_DLG1_vsw_9-DOCK_HTVS_1-001 | Acalabrutinib | -6.53604 | -6.55014 | -51.4479 |
HKFP_277_PAK2_DLG1_vsw_9-DOCK_HTVS_1-001 | Lapatinib | -6.4894300000000005 | -6.5782300000000005 | -53.0537 |
HKFP_277_PAK2_DLG1_vsw_9-DOCK_HTVS_1-001 | Erdafitinib | -6.43231 | -6.43251 | -37.0752 |
HKFP_277_PAK2_DLG1_vsw_9-DOCK_HTVS_1-001 | Abrocitinib | -6.1797900000000014 | -6.19089 | -33.4456 |
HKFP_277_PAK2_DLG1_vsw_9-DOCK_HTVS_1-001 | Abrocitinib | -6.1797900000000014 | -6.19089 | -33.4456 |
HKFP_277_PAK2_DLG1_vsw_9-DOCK_HTVS_1-001 | Temsirolimus | -6.16424 | -6.16564 | -55.6261 |
HKFP_277_PAK2_DLG1_vsw_9-DOCK_HTVS_1-001 | Abemaciclib | -6.06267 | -6.26477 | -48.6688 |
HKFP_277_PAK2_DLG1_vsw_9-DOCK_HTVS_1-001 | Abemaciclib | -6.06267 | -6.26477 | -48.6688 |
HKFP_277_PAK2_DLG1_vsw_9-DOCK_HTVS_1-001 | Abemaciclib | -6.06267 | -6.26477 | -48.6688 |
HKFP_277_PAK2_DLG1_vsw_9-DOCK_HTVS_1-001 | Abemaciclib | -6.06267 | -6.26477 | -48.6688 |
HKFP_277_PAK2_DLG1_vsw_9-DOCK_HTVS_1-001 | Ruxolitinib | -6.02963 | -6.02963 | -38.2843 |
HKFP_277_PAK2_DLG1_vsw_9-DOCK_HTVS_1-001 | Tivozanib | -6.00515 | -6.00515 | -46.3396 |
HKFP_277_PAK2_DLG1_vsw_9-DOCK_HTVS_1-001 | Larotrectinib | -6.00139 | -6.00139 | -48.5831 |
HKFP_277_PAK2_DLG1_vsw_9-DOCK_HTVS_1-001 | Dabrafenib | -5.95169 | -6.35709 | -46.3626 |
HKFP_277_PAK2_DLG1_vsw_9-DOCK_HTVS_1-001 | Tofacitinib | -5.9086 | -5.9201 | -37.2353 |
190_PAK2_DLG1-DOCK_HTVS_1-001 | Netarsudil | -5.55924 | -5.57034 | -44.7887 |
190_PAK2_DLG1-DOCK_HTVS_1-001 | Netarsudil | -5.55924 | -5.57034 | -44.7887 |
190_PAK2_DLG1-DOCK_HTVS_1-001 | Lapatinib | -5.37098 | -5.45978 | -58.1976 |
190_PAK2_DLG1-DOCK_HTVS_1-001 | Nilotinib | -5.2542599999999995 | -5.39386 | -29.6831 |
190_PAK2_DLG1-DOCK_HTVS_1-001 | Nilotinib | -5.2542599999999995 | -5.39386 | -29.6831 |
190_PAK2_DLG1-DOCK_HTVS_1-001 | Tofacitinib | -5.13585 | -5.14735 | -31.8735 |
190_PAK2_DLG1-DOCK_HTVS_1-001 | Tofacitinib | -5.13585 | -5.14735 | -31.8735 |
190_PAK2_DLG1-DOCK_HTVS_1-001 | Baricitinib | -5.05671 | -5.05671 | -47.018 |
190_PAK2_DLG1-DOCK_HTVS_1-001 | Neratinib | -4.995480000000001 | -5.17778 | -58.0674 |
190_PAK2_DLG1-DOCK_HTVS_1-001 | Neratinib | -4.995480000000001 | -5.17778 | -58.0674 |
190_PAK2_DLG1-DOCK_HTVS_1-001 | Ruxolitinib | -4.86524 | -4.86524 | -36.1834 |
190_PAK2_DLG1-DOCK_HTVS_1-001 | Afatinib | -4.7046 | -4.8869 | -41.0927 |
190_PAK2_DLG1-DOCK_HTVS_1-001 | Afatinib | -4.7046 | -4.8869 | -41.0927 |
190_PAK2_DLG1-DOCK_HTVS_1-001 | Pexidartinib | -4.70359 | -5.40439 | -38.0163 |
190_PAK2_DLG1-DOCK_HTVS_1-001 | Pexidartinib | -4.70359 | -5.40439 | -38.0163 |
190_PAK2_DLG1-DOCK_HTVS_1-001 | Afatinib | -4.7032 | -4.8869 | -41.0927 |
190_PAK2_DLG1-DOCK_HTVS_1-001 | Ruxolitinib | -4.67865 | -4.67865 | -34.3508 |
190_PAK2_DLG1-DOCK_HTVS_1-001 | Netarsudil | -4.61177 | -4.62287 | -42.2707 |
190_PAK2_DLG1-DOCK_HTVS_1-001 | Netarsudil | -4.61177 | -4.62287 | -42.2707 |
190_PAK2_DLG1-DOCK_HTVS_1-001 | Midostaurin | -4.58643 | -4.58643 | -40.5254 |
Top |
Kinase-Substrate Information of PAK2_DLG1 |
Phosphorylation target of the kinase (phosphosite, 03-17-2024) |
Kinase | Kinase UniProt Acc | Kinase species | Substrate | Substrate UniProt Acc | Substrate phosphorylated residues | Substrate phosphorylated sites (+/-7AA) | Domain |
PAK2 | Q13177 | human | MYC | P01106 | S388 | RRNELkRsFFALRDQ | HLH |
PAK2 | Q13177 | human | ARHGAP15 | Q53QZ3 | S292 | kVCERENsTVPWFVk | |
PAK2 | Q13177 | human | H4C1 | P62805 | S47 | RGGVKrIsGLIyEEt | CENP-T_C |
PAK2 | Q13177 | human | JUN | P05412 | T2 | ______MtAKMETtF | |
PAK2 | Q13177 | human | CALD1 | Q05682 | S744 | GLKVGVSsRINEWLT | Caldesmon |
PAK2 | Q13177 | human | JUN | P05412 | T286 | RLEEKVKtLKAQNSE | bZIP_1 |
PAK2 | Q13177 | human | MYC | P01106 | T373 | EENVkRRtHNVLERQ | HLH |
PAK2 | Q13177 | human | MICAL1 | Q8TDZ2 | S817 | sPERQRLssLNLtPD | |
PAK2 | Q13177 | human | SORT1 | Q99523 | S793 | RFLVHRYsVLQQHAE | |
PAK2 | Q13177 | human | CASP7 | P55210 | S239 | WRsPGRGsWFVQALC | Peptidase_C14 |
PAK2 | Q13177 | human | ABL1 | P00519 | S619 | PtPPKRsssFREMDG | |
PAK2 | Q13177 | human | PAK2 | Q13177 | S192 | PRPDHTksIytRsVI | |
PAK2 | Q13177 | human | PAK2 | Q13177 | S141 | tVkQKyLsFtPPEkd | |
PAK2 | Q13177 | human | SMAD2 | Q15796 | S467 | sVRCssMs_______ | |
PAK2 | Q13177 | human | NF2 | P35240 | S518 | DTDMKRLsMEIEKEK | ERM_C |
PAK2 | Q13177 | human | SMAD2 | Q15796 | S417 | RMCTIRMsFVkGWGA | MH2 |
PAK2 | Q13177 | human | EIF4G1 | Q04637 | S895 | RDIARRRsLGNIkFI | MIF4G |
PAK2 | Q13177 | human | ARHGAP15 | Q53QZ3 | S4 | ____MQKsTNsDTSV | |
PAK2 | Q13177 | human | ARHGAP15 | Q53QZ3 | S43 | DRLsQsksMILTDVG | |
PAK2 | Q13177 | human | PAK2 | Q13177 | T402 | PEQSkRstMVGtPYW | Pkinase |
PAK2 | Q13177 | human | JUN | P05412 | T8 | MtAKMETtFYDDALN | Jun |
PAK2 | Q13177 | human | SMAD2 | Q15796 | S465 | sPsVRCssMs_____ | |
PAK2 | Q13177 | human | MYC | P01106 | T415 | VVILKkAtAYILsVQ | HLH |
PAK2 | Q13177 | human | PXN | P49023 | S272 | ELDELMAsLsDFkIQ | |
PAK2 | Q13177 | human | CASP7 | P55210 | S30 | DAKPDRssFVPsLFs | |
PAK2 | Q13177 | human | CALD1 | Q05682 | S714 | EGVRNIksMWEkGNV | Caldesmon |
PAK2 | Q13177 | human | ARHGAP15 | Q53QZ3 | S41 | HHDRLsQsksMILTD | |
PAK2 | Q13177 | human | MAPK6 | Q16659 | S189 | ySHKGHLsEGLVTkW | Pkinase |
PAK2 | Q13177 | human | PXN | P49023 | S274 | DELMAsLsDFkIQGL | |
PAK2 | Q13177 | human | PAK2 | Q13177 | S197 | TksIytRsVIDPVPA | |
PAK2 | Q13177 | human | CASP7 | P55210 | T173 | FRGDRCktLLEkPKL | Peptidase_C14 |
PAK2 | Q13177 | human | CTNNB1 | P35222 | S552 | QDtQRRtsMGGtQQQ | |
PAK2 | Q13177 | human | SMAD2 | Q15796 | S464 | GsPsVRCssMs____ | |
PAK2 | Q13177 | human | JUN | P05412 | T89 | QSSNGHItTtPtPtQ | Jun |
PAK2 | Q13177 | human | PREX2 | Q70Z35 | S1107 | DTISNRDsYSDCNSN | |
PAK2 | Q13177 | human | RAF1 | P04049 | S338 | RPRGQRDssyyWEIE | |
PAK2 | Q13177 | human | MICAL1 | Q8TDZ2 | S960 | ELALRRQssSPEQQK | bMERB_dom |
PAK2 | Q13177 | human | HACE1 | Q8IYU2 | S385 | LMKNKRDsTEITsIL | |
PAK2 | Q13177 | human | SLC25A5 | P05141 | T107 | LGGVDkRtQFWLyFA | |
PAK2 | Q13177 | human | JUN | P05412 | T93 | GHItTtPtPtQFLCP | Jun |
PAK2 | Q13177 | human | ABL1 | P00519 | S618 | APtPPKRsssFREMD |
Biological Network Integration of This Kinase and Substrates (GeneMANIA website) |
Enriched GO biological processes of the phosphorylation target genes of the kinase |
Kinase | GOID | GO term | P.adjust |
PAK2 | ID | Description | 0.00e+00 |
PAK2 | GO:0051017 | actin filament bundle assembly | 9.20e-06 |
PAK2 | GO:0061572 | actin filament bundle organization | 9.20e-06 |
PAK2 | GO:0051492 | regulation of stress fiber assembly | 7.93e-04 |
PAK2 | GO:0110020 | regulation of actomyosin structure organization | 7.93e-04 |
PAK2 | GO:0031400 | negative regulation of protein modification process | 7.93e-04 |
PAK2 | GO:0032231 | regulation of actin filament bundle assembly | 7.93e-04 |
PAK2 | GO:0030038 | contractile actin filament bundle assembly | 7.93e-04 |
PAK2 | GO:0043149 | stress fiber assembly | 7.93e-04 |
PAK2 | GO:0007015 | actin filament organization | 8.86e-04 |
PAK2 | GO:0071560 | cellular response to transforming growth factor beta stimulus | 1.30e-03 |
PAK2 | GO:0071559 | response to transforming growth factor beta | 1.31e-03 |
PAK2 | GO:0001933 | negative regulation of protein phosphorylation | 1.43e-03 |
PAK2 | GO:0048538 | thymus development | 1.75e-03 |
PAK2 | GO:0042326 | negative regulation of phosphorylation | 1.75e-03 |
PAK2 | GO:0051496 | positive regulation of stress fiber assembly | 1.76e-03 |
PAK2 | GO:0032233 | positive regulation of actin filament bundle assembly | 2.69e-03 |
PAK2 | GO:0045936 | negative regulation of phosphate metabolic process | 2.69e-03 |
PAK2 | GO:0010563 | negative regulation of phosphorus metabolic process | 2.69e-03 |
PAK2 | GO:0007440 | foregut morphogenesis | 3.13e-03 |
PAK2 | GO:2001233 | regulation of apoptotic signaling pathway | 3.13e-03 |
PAK2 | GO:0031032 | actomyosin structure organization | 3.71e-03 |
PAK2 | GO:0009950 | dorsal/ventral axis specification | 4.07e-03 |
PAK2 | GO:0051346 | negative regulation of hydrolase activity | 4.07e-03 |
PAK2 | GO:0034333 | adherens junction assembly | 4.44e-03 |
PAK2 | GO:0016358 | dendrite development | 4.84e-03 |
PAK2 | GO:0048145 | regulation of fibroblast proliferation | 5.40e-03 |
PAK2 | GO:0007264 | small GTPase mediated signal transduction | 5.67e-03 |
PAK2 | GO:0045638 | negative regulation of myeloid cell differentiation | 5.67e-03 |
PAK2 | GO:0060192 | negative regulation of lipase activity | 5.67e-03 |
PAK2 | GO:0001657 | ureteric bud development | 5.67e-03 |
PAK2 | GO:0048534 | hematopoietic or lymphoid organ development | 5.67e-03 |
PAK2 | GO:0051098 | regulation of binding | 5.67e-03 |
PAK2 | GO:0072163 | mesonephric epithelium development | 5.67e-03 |
PAK2 | GO:0072164 | mesonephric tubule development | 5.67e-03 |
PAK2 | GO:0001823 | mesonephros development | 6.19e-03 |
PAK2 | GO:0110053 | regulation of actin filament organization | 6.19e-03 |
PAK2 | GO:0048144 | fibroblast proliferation | 6.56e-03 |
PAK2 | GO:0051056 | regulation of small GTPase mediated signal transduction | 7.89e-03 |
PAK2 | GO:0007398 | ectoderm development | 8.04e-03 |
PAK2 | GO:0002065 | columnar/cuboidal epithelial cell differentiation | 9.15e-03 |
PAK2 | GO:0002053 | positive regulation of mesenchymal cell proliferation | 9.35e-03 |
PAK2 | GO:0035994 | response to muscle stretch | 9.35e-03 |
PAK2 | GO:0048011 | neurotrophin TRK receptor signaling pathway | 9.35e-03 |
PAK2 | GO:0001704 | formation of primary germ layer | 9.35e-03 |
PAK2 | GO:0044346 | fibroblast apoptotic process | 9.78e-03 |
PAK2 | GO:0032956 | regulation of actin cytoskeleton organization | 1.08e-02 |
PAK2 | GO:0031589 | cell-substrate adhesion | 1.30e-02 |
PAK2 | GO:0033688 | regulation of osteoblast proliferation | 1.31e-02 |
PAK2 | GO:0072073 | kidney epithelium development | 1.34e-02 |
Top |
Related Drugs to PAK2_DLG1 |
Drugs used for this fusion-positive patient. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Drug | Source | PMID |
Distribution of the number of studies mentioning PAK2-DLG1 and kinase inhibitors the PubMed Abstract (04-01-2024) |
Fusion gene - drug pair 1 | Fusion gene - drug pair 2 | PMID | Publication date | DOI | Study title |
Top |
Related Diseases to PAK2_DLG1 |
Diseases that have this fusion gene. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Disease | Source | PMID |
Related diseases from the literature mentioned this fusion gene and drug. (PubMed, 04-01-2024) |
MeSH ID | MeSH term |
Diseases associated with fusion partners. (DisGeNet 4.0) |
Partner | Gene | Disease ID | Disease name | # pubmeds | Source |
Top |
Clinical Trials of the Found Drugs/Small Molecules |
Statistics of the Clinical Trials of the Found Kinase Inibitors from clinicaltrials.gov (06-17-2024) |
Clinical Trials from clinicaltrials.gov (06-17-2024) |
Fusion Gene | Kinase Inhibitor | NCT ID | Study Status | Phases | Disease | # Enrolment | Date |