UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
|
Kinase Fusion Gene:PRKD2_GLUD1 |
Kinase Fusion Protein Summary |
Kinase Fusion gene summary |
Kinase Fusion partner gene information | Kinase Fusion gene name: PRKD2_GLUD1 | KinaseFusionDB ID: KFG5004 | FusionGDB2.0 ID: KFG5004 | Hgene | Tgene | Gene symbol | PRKD2 | GLUD1 | Gene ID | 25865 | 2746 | |
Gene name | protein kinase D2 | glutamate dehydrogenase 1 | ||||||||||
Synonyms | HSPC187|PKD2|nPKC-D2 | GDH|GDH1|GLUD|hGDH1 | ||||||||||
Cytomap | 19q13.32 | 10q23.2 | ||||||||||
Type of gene | protein-coding | protein-coding | ||||||||||
Description | serine/threonine-protein kinase D2 | glutamate dehydrogenase 1, mitochondrialepididymis secretory sperm binding proteinepididymis tissue sperm binding protein Li 18mPglutamate dehydrogenase (NAD(P)+) | ||||||||||
Modification date | 20240411 | 20240411 | ||||||||||
UniProtAcc | Q9BZL6 | P00367 | ||||||||||
Ensembl transtripts involved in fusion gene | ENST ids | ENST00000291281, ENST00000433867, ENST00000595515, ENST00000600194, ENST00000601806, ENST00000593492, | ENST00000465164, ENST00000277865, ENST00000537649, ENST00000544149, | |||||||||
Context (manual curation of fusion genes in KinaseFusionDB) | PubMed: PRKD2 [Title/Abstract] AND GLUD1 [Title/Abstract] AND fusion [Title/Abstract] | |||||||||||
Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) | PRKD2(47192794)-GLUD1(88819030), # samples:1 |
Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
Partner | Gene | GO ID | GO term | PubMed ID |
Hgene | PRKD2 | GO:0006468 | protein phosphorylation | 22228765 |
Hgene | PRKD2 | GO:0045944 | positive regulation of transcription by RNA polymerase II | 17077180 |
Hgene | PRKD2 | GO:0046777 | protein autophosphorylation | 17077180 |
Hgene | PRKD2 | GO:0050852 | T cell receptor signaling pathway | 17077180 |
Tgene | GLUD1 | GO:0006537 | glutamate biosynthetic process | 11032875 |
Tgene | GLUD1 | GO:0006538 | glutamate catabolic process | 6121377|11032875 |
Kinase Fusion gene breakpoints across PRKD2 (5'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Kinase Fusion gene breakpoints across GLUD1 (3'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Top |
Kinase Fusion Gene Sample Information |
Kinase Fusion gene information. |
Kinase Fusion gene information from four resources (ChiTars 5.0, ChimerDB 4.0, COSMIC, and CCLE) * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
Source | Sample | Hgene | Hchr | Hbp | Tgene | Tchr | Tbp |
ChimerDB4 | TCGA-J4-A67S-01A | PRKD2 | chr19 | 47192794 | GLUD1 | chr10 | 88819030 |
Top |
Kinase Fusion ORF Analysis |
Kinase Fusion information from ORFfinder translation from full-length transcript sequence from KinaseFusionDB. |
Henst | Tenst | Hgene | Hchr | Hbp | Tgene | Tchr | Tbp | Seq length (transcript) | Seq length (amino acids) |
ENST00000291281 | ENST00000277865 | PRKD2 | chr19 | 47192794 | GLUD1 | chr10 | 88819030 | 3861 | 822 |
Top |
Kinase Fusion Amino Acid Sequences |
For individual full-length fusion transcript sequence from KinaseFusionDB, we ran ORFfinder and chose the longest ORF among the all predicted ones. |
>Henst_Tenst_Hgene_Hchr_Hbp_Tgene_Tchr_Tbp_length(fusion AA)_AAseq >ENST00000291281_ENST00000277865_PRKD2_chr19_47192794_GLUD1_chr10_88819030_length(amino acids)=822 MLTRSRGSRTQGPPGPPGRVPGGLQAAGPRPPPMATAPSYPAGLPGSPGPGSPPPPGGLELQSPPPLLPQIPAPGSGVSFHIQIGLTREF VLLPAASELAHVKQLACSIVDQKFPECGFYGLYDKILLFKHDPTSANLLQLVRSSGDIQEGDLVEVVLSASATFEDFQIRPHALTVHSYR APAFCDHCGEMLFGLVRQGLKCDGCGLNYHKRCAFSIPNNCSGARKRRLSSTSLASGHSVRLGTSESLPCTAEELSRSTTELLPRRPPSS SSSSSASSYTGRPIELDKMLLSKVKVPHTFLIHSYTRPTVCQACKKLLKGLFRQGLQCKDCKFNCHKRCATRVPNDCLGEALINGDVPME EATDFSEADKSALMDESEDSGVIPGSHSENALHASEEEEGEGGKAQSSLGYIPLMRVVQSVRHTTRKSSTTLREGWVVHYSNKDTLRKRH YWRLDCKCITLFQNNTTNRYYKEIPLSEILTVESAQNFSLVPPGTNPHCFEIVTANATYFVGEMPGGTPGGPSGQGAEAARGWETAIRQA LMPVILQDAPSAPGHAPHRQASLSISVSNSQIQENVDIATVYQIFPDEVLGSGQFGVVYGGKHRKTGRDVAVKVIDKLRFPTKQESQLRN EVAILQSLRHPGIVNLECMFETPEKVFVVMEKLHGDMLEMILSSEKGRLPERLTKFLITQDLYLNAGGVTVSYFEWLKNLNHVSYGRLTF KYERDSNYHLLMSVQESLERKFGKHGGTIPIVPTAEFQDRISGASEKDIVHSGLAYTMERSARQIMRTAMKYNLGLDLRTAAYVNAIEKV -------------------------------------------------------------- |
Multiple Sequence Alignment of All Fusion Protein Isoforms |
Top |
Kinase Fusion Protein Functional Features |
Four levels of functional features of fusion genes Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr19:47192794/chr10:88819030) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
Main function of each fusion partner protein. (from UniProt) |
Hgene | Tgene |
PRKD2 | GLUD1 |
FUNCTION: Serine/threonine-protein kinase that converts transient diacylglycerol (DAG) signals into prolonged physiological effects downstream of PKC, and is involved in the regulation of cell proliferation via MAPK1/3 (ERK1/2) signaling, oxidative stress-induced NF-kappa-B activation, inhibition of HDAC7 transcriptional repression, signaling downstream of T-cell antigen receptor (TCR) and cytokine production, and plays a role in Golgi membrane trafficking, angiogenesis, secretory granule release and cell adhesion (PubMed:15604256, PubMed:14743217, PubMed:17077180, PubMed:16928771, PubMed:17962809, PubMed:17951978, PubMed:18262756, PubMed:19192391, PubMed:19001381, PubMed:23503467, PubMed:28428613). May potentiate mitogenesis induced by the neuropeptide bombesin by mediating an increase in the duration of MAPK1/3 (ERK1/2) signaling, which leads to accumulation of immediate-early gene products including FOS that stimulate cell cycle progression (By similarity). In response to oxidative stress, is phosphorylated at Tyr-438 and Tyr-717 by ABL1, which leads to the activation of PRKD2 without increasing its catalytic activity, and mediates activation of NF-kappa-B (PubMed:15604256, PubMed:28428613). In response to the activation of the gastrin receptor CCKBR, is phosphorylated at Ser-244 by CSNK1D and CSNK1E, translocates to the nucleus, phosphorylates HDAC7, leading to nuclear export of HDAC7 and inhibition of HDAC7 transcriptional repression of NR4A1/NUR77 (PubMed:17962809). Upon TCR stimulation, is activated independently of ZAP70, translocates from the cytoplasm to the nucleus and is required for interleukin-2 (IL2) promoter up-regulation (PubMed:17077180). During adaptive immune responses, is required in peripheral T-lymphocytes for the production of the effector cytokines IL2 and IFNG after TCR engagement and for optimal induction of antibody responses to antigens (By similarity). In epithelial cells stimulated with lysophosphatidic acid (LPA), is activated through a PKC-dependent pathway and mediates LPA-stimulated interleukin-8 (IL8) secretion via a NF-kappa-B-dependent pathway (PubMed:16928771). During TCR-induced T-cell activation, interacts with and is activated by the tyrosine kinase LCK, which results in the activation of the NFAT transcription factors (PubMed:19192391). In the trans-Golgi network (TGN), regulates the fission of transport vesicles that are on their way to the plasma membrane and in polarized cells is involved in the transport of proteins from the TGN to the basolateral membrane (PubMed:14743217). Plays an important role in endothelial cell proliferation and migration prior to angiogenesis, partly through modulation of the expression of KDR/VEGFR2 and FGFR1, two key growth factor receptors involved in angiogenesis (PubMed:19001381). In secretory pathway, is required for the release of chromogranin-A (CHGA)-containing secretory granules from the TGN (PubMed:18262756). Downstream of PRKCA, plays important roles in angiotensin-2-induced monocyte adhesion to endothelial cells (PubMed:17951978). Plays a regulatory role in angiogenesis and tumor growth by phosphorylating a downstream mediator CIB1 isoform 2, resulting in vascular endothelial growth factor A (VEGFA) secretion (PubMed:23503467). {ECO:0000250|UniProtKB:Q8BZ03, ECO:0000269|PubMed:14743217, ECO:0000269|PubMed:15604256, ECO:0000269|PubMed:16928771, ECO:0000269|PubMed:17077180, ECO:0000269|PubMed:17951978, ECO:0000269|PubMed:17962809, ECO:0000269|PubMed:18262756, ECO:0000269|PubMed:19001381, ECO:0000269|PubMed:19192391, ECO:0000269|PubMed:23503467, ECO:0000269|PubMed:28428613}. | FUNCTION: Mitochondrial glutamate dehydrogenase that catalyzes the conversion of L-glutamate into alpha-ketoglutarate. Plays a key role in glutamine anaplerosis by producing alpha-ketoglutarate, an important intermediate in the tricarboxylic acid cycle (PubMed:11032875, PubMed:16959573, PubMed:11254391, PubMed:16023112). Plays a role in insulin homeostasis (PubMed:9571255, PubMed:11297618). May be involved in learning and memory reactions by increasing the turnover of the excitatory neurotransmitter glutamate (By similarity). {ECO:0000250|UniProtKB:P10860, ECO:0000269|PubMed:11032875, ECO:0000269|PubMed:11254391, ECO:0000269|PubMed:11297618, ECO:0000269|PubMed:16023112, ECO:0000269|PubMed:16959573, ECO:0000269|PubMed:9571255}. |
Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
- Retained domain in the 5'-partner of fusion protein (protein functional feature from UniProt). |
Partner | Hgeneene | Hbp | Tgeneene | Tbp | ENST | BPexon | TotalExon | Protein feature loci | BPloci | TotalLen | Feature | Note |
Hgene | PRKD2 | 47192794 | GLUD1 | 88819030 | ENST00000291281 | 14 | 18 | 397_509 | 6571 | 879 | Domain | Note=PH;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00145 |
Hgene | PRKD2 | 47192794 | GLUD1 | 88819030 | ENST00000291281 | 15 | 19 | 397_509 | 6571 | 879 | Domain | Note=PH;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00145 |
- Retained domain in the 3'-partner of fusion protein (protein functional feature from UniProt). |
Partner | Hgeneene | Hbp | Tgeneene | Tbp | ENST | BPexon | TotalExon | Protein feature loci | BPloci | TotalLen | Feature | Note |
Top |
Kinase Fusion Protein Structures |
CIF files of the predicted kinase fusion proteins * Here we show the 3D structure of the fusion proteins using Mol*. AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Model confidence is shown from the pLDDT values per residue. pLDDT corresponds to the model’s prediction of its score on the local Distance Difference Test. It is a measure of local accuracy (from AlphfaFold website). To color code individual residues, we transformed individual PDB files into CIF format. |
Kinase Fusion protein CIF link (fusion AA seq ID in KinaseFusionDB) | Henst | Tenst | Hgene | Hchr | Hbp | Tgene | Tchr | Tbp | AA seq | Len(AA seq) |
PDB file >>>210_PRKD2_GLUD1 | ENST00000291281 | ENST00000277865 | PRKD2 | chr19 | 47192794 | GLUD1 | chr10 | 88819030 | MLTRSRGSRTQGPPGPPGRVPGGLQAAGPRPPPMATAPSYPAGLPGSPGPGSPPPPGGLELQSPPPLLPQIPAPGSGVSFHIQIGLTREF VLLPAASELAHVKQLACSIVDQKFPECGFYGLYDKILLFKHDPTSANLLQLVRSSGDIQEGDLVEVVLSASATFEDFQIRPHALTVHSYR APAFCDHCGEMLFGLVRQGLKCDGCGLNYHKRCAFSIPNNCSGARKRRLSSTSLASGHSVRLGTSESLPCTAEELSRSTTELLPRRPPSS SSSSSASSYTGRPIELDKMLLSKVKVPHTFLIHSYTRPTVCQACKKLLKGLFRQGLQCKDCKFNCHKRCATRVPNDCLGEALINGDVPME EATDFSEADKSALMDESEDSGVIPGSHSENALHASEEEEGEGGKAQSSLGYIPLMRVVQSVRHTTRKSSTTLREGWVVHYSNKDTLRKRH YWRLDCKCITLFQNNTTNRYYKEIPLSEILTVESAQNFSLVPPGTNPHCFEIVTANATYFVGEMPGGTPGGPSGQGAEAARGWETAIRQA LMPVILQDAPSAPGHAPHRQASLSISVSNSQIQENVDIATVYQIFPDEVLGSGQFGVVYGGKHRKTGRDVAVKVIDKLRFPTKQESQLRN EVAILQSLRHPGIVNLECMFETPEKVFVVMEKLHGDMLEMILSSEKGRLPERLTKFLITQDLYLNAGGVTVSYFEWLKNLNHVSYGRLTF KYERDSNYHLLMSVQESLERKFGKHGGTIPIVPTAEFQDRISGASEKDIVHSGLAYTMERSARQIMRTAMKYNLGLDLRTAAYVNAIEKV | 822 |
3D view using mol* of 210_PRKD2_GLUD1 | ||||||||||
PDB file >>>HKFP_300_PRKD2_GLUD1 | ENST00000291281 | ENST00000277865 | PRKD2 | chr19 | 47192794 | GLUD1 | chr10 | 88819030 | MLTRSRGSRTQGPPGPPGRVPGGLQAAGPRPPPMATAPSYPAGLPGSPGPGSPPPPGGLELQSPPPLLPQIPAPGSGVSFHIQIGLTREF VLLPAASELAHVKQLACSIVDQKFPECGFYGLYDKILLFKHDPTSANLLQLVRSSGDIQEGDLVEVVLSASATFEDFQIRPHALTVHSYR APAFCDHCGEMLFGLVRQGLKCDGCGLNYHKRCAFSIPNNCSGARKRRLSSTSLASGHSVRLGTSESLPCTAEELSRSTTELLPRRPPSS SSSSSASSYTGRPIELDKMLLSKVKVPHTFLIHSYTRPTVCQACKKLLKGLFRQGLQCKDCKFNCHKRCATRVPNDCLGEALINGDVPME EATDFSEADKSALMDESEDSGVIPGSHSENALHASEEEEGEGGKAQSSLGYIPLMRVVQSVRHTTRKSSTTLREGWVVHYSNKDTLRKRH YWRLDCKCITLFQNNTTNRYYKEIPLSEILTVESAQNFSLVPPGTNPHCFEIVTANATYFVGEMPGGTPGGPSGQGAEAARGWETAIRQA LMPVILQDAPSAPGHAPHRQASLSISVSNSQIQENVDIATVYQIFPDEVLGSGQFGVVYGGKHRKTGRDVAVKVIDKLRFPTKQESQLRN EVAILQSLRHPGIVNLECMFETPEKVFVVMEKLHGDMLEMILSSEKGRLPERLTKFLITQDLYLNAGGVTVSYFEWLKNLNHVSYGRLTF KYERDSNYHLLMSVQESLERKFGKHGGTIPIVPTAEFQDRISGASEKDIVHSGLAYTMERSARQIMRTAMKYNLGLDLRTAAYVNAIEKV | 822_PRKD2_GLUD1 |
Top |
Comparison of Fusion Protein Isoforms |
Superimpose the 3D Structures Among All Fusion Protein Isoforms * Download the pdb file and open it from the molstar online viewer. |
Comparison of the Secondary Structures of Fusion Protein Isoforms |
Top |
Comparison of Fusion Protein Sequences/Structures with Known Sequences/Structures from PDB |
Top |
pLDDT score distribution |
pLDDT score distribution of the predicted fusion protein structures from AlphaFold2 * AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. * The blue color at the bottom marks the best active site residues. |
210_PRKD2_GLUD1.png |
210_PRKD2_GLUD1.png |
Top |
Potential Active Site Information |
The potential binding sites of these fusion proteins were identified using SiteMap, a module of the Schrodinger suite. |
Kinase Fusion AA seq ID in KinaseFusionDB | Site score | Size | Dscore | Volume | Exposure | Enclosure | Contact | Phobic | Philic | Balance | Don/Acc | Residues |
Top |
Ramachandran Plot of Kinase Fusion Protein Structure |
Ramachandran plot of the torsional angles - phi (φ)and psi (ψ) - of the residues (amino acids) contained in this fusion protein peptide. |
210_PRKD2_GLUD1_ramachandran.png |
Top |
Virtual Screening Results |
Distribution of the average docking score across all approved kinase inhibitors. Distribution of the number of occurrence across all approved kinase inhibitors. |
5'-kinase fusion protein case |
3'-kinase fusion protein case |
Top |
Drug information from DrugBank of the top 20 interacting small molecules. * The detailed information of individual kinase inhibitors are available in the download page. |
Fusion gene name info | Drug | Docking score | Glide g score | Glide energy |
210_PRKD2_GLUD1-DOCK_HTVS_1-001 | Neratinib | -6.14586 | -6.32816 | -52.6715 |
210_PRKD2_GLUD1-DOCK_HTVS_1-001 | Neratinib | -6.14586 | -6.32816 | -52.6715 |
210_PRKD2_GLUD1-DOCK_HTVS_1-001 | Neratinib | -6.09971 | -6.28561 | -52.1756 |
210_PRKD2_GLUD1-DOCK_HTVS_1-001 | Lapatinib | -5.3913199999999994 | -5.480119999999999 | -53.5806 |
210_PRKD2_GLUD1-DOCK_HTVS_1-001 | Neratinib | -5.13839 | -5.32429 | -45.6199 |
210_PRKD2_GLUD1-DOCK_HTVS_1-001 | Neratinib | -5.11088 | -5.29318 | -45.4184 |
210_PRKD2_GLUD1-DOCK_HTVS_1-001 | Neratinib | -5.11088 | -5.29318 | -45.4184 |
210_PRKD2_GLUD1-DOCK_HTVS_1-001 | Tepotinib | -4.742780000000001 | -4.74388 | -47.8353 |
210_PRKD2_GLUD1-DOCK_HTVS_1-001 | Temsirolimus | -4.69736 | -4.69876 | -41.2321 |
210_PRKD2_GLUD1-DOCK_HTVS_1-001 | Neratinib | -4.658919999999999 | -5.56122 | -47.3981 |
210_PRKD2_GLUD1-DOCK_HTVS_1-001 | Neratinib | -4.658919999999999 | -5.56122 | -47.3981 |
210_PRKD2_GLUD1-DOCK_HTVS_1-001 | Afatinib | -4.59171 | -4.77401 | -43.9059 |
210_PRKD2_GLUD1-DOCK_HTVS_1-001 | Afatinib | -4.59171 | -4.77401 | -43.9059 |
210_PRKD2_GLUD1-DOCK_HTVS_1-001 | Afatinib | -4.59031 | -4.77401 | -43.9059 |
210_PRKD2_GLUD1-DOCK_HTVS_1-001 | Binimetinib | -4.57811 | -4.58681 | -34.4498 |
210_PRKD2_GLUD1-DOCK_HTVS_1-001 | Binimetinib | -4.57811 | -4.58681 | -34.4498 |
210_PRKD2_GLUD1-DOCK_HTVS_1-001 | Alectinib | -4.53688 | -4.68898 | -41.3636 |
210_PRKD2_GLUD1-DOCK_HTVS_1-001 | Alectinib | -4.53688 | -4.68898 | -41.3636 |
210_PRKD2_GLUD1-DOCK_HTVS_1-001 | Neratinib | -4.50539 | -5.41129 | -47.9236 |
210_PRKD2_GLUD1-DOCK_HTVS_1-001 | Larotrectinib | -4.46285 | -4.46285 | -32.4181 |
Top |
Kinase-Substrate Information of PRKD2_GLUD1 |
Phosphorylation target of the kinase (phosphosite, 03-17-2024) |
Kinase | Kinase UniProt Acc | Kinase species | Substrate | Substrate UniProt Acc | Substrate phosphorylated residues | Substrate phosphorylated sites (+/-7AA) | Domain |
PRKD2 | Q9BZL6 | human | IFNAR1 | P17181 | S535 | SSQTsQDsGNysNED | |
PRKD2 | Q9BZL6 | human | PAK4 | O96013 | S99 | MsVTRsNsLRRDsPP | |
PRKD2 | Q9BZL6 | human | PI4KB | Q9UBF8-2 | S294 | SNLKRtAsNPKVENE | |
PRKD2 | Q9BZL6 | human | CTTN | Q14247 | S298 | EKLAkHEsQQDyskG | HS1_rep |
PRKD2 | Q9BZL6 | human | SET | Q01105-2 | S171 | KDLTKRSsQTQNKAs | NAP |
PRKD2 | Q9BZL6 | human | ARFIP1 | P53367-2 | S100 | LELVRKWsLNTYKCT | Arfaptin |
PRKD2 | Q9BZL6 | human | ITGB4 | P16144-2 | T1736 | EFVSRTLttSGTLST | |
PRKD2 | Q9BZL6 | human | MFF | Q9GZY8 | S172 | GQLVRNDsLWHRsDs | Miff |
PRKD2 | Q9BZL6 | human | CIB1 | Q99828 | S78 | ERICRVFsTSPAKDS | |
PRKD2 | Q9BZL6 | human | VASP | P50552 | S239 | GAKLRKVsKQEEASG | |
PRKD2 | Q9BZL6 | human | HDAC7 | Q8WUI4 | S181 | NPLLRKEsAPPsLRR | |
PRKD2 | Q9BZL6 | human | SSH1 | Q8WYL5 | S978 | sPLKRSHsLAKLGSL | |
PRKD2 | Q9BZL6 | human | HDAC5 | Q9UQL6 | S498 | RPLSRtQsSPLPQsP | |
PRKD2 | Q9BZL6 | human | PKD2 | Q13563 | S801 | SSLPRPMsSRSFPRs | |
PRKD2 | Q9BZL6 | human | MARK2 | Q7KZI7 | S400 | HkVQRsVsANPKQRR | |
PRKD2 | Q9BZL6 | human | PRKD2 | Q9BZL6 | S876 | QGLAERIsVL_____ | |
PRKD2 | Q9BZL6 | human | RIN1 | Q13671 | S292 | QLLRREssVGyRVPA | |
PRKD2 | Q9BZL6 | human | SSH1 | Q8WYL5 | S937 | SNLtRssssDsIHsV | |
PRKD2 | Q9BZL6 | human | VASP | P50552 | S157 | EHIERRVsNAGGPPA | |
PRKD2 | Q9BZL6 | human | VASP | P50552 | S322 | TtLPRMkssssVttS |
Biological Network Integration of This Kinase and Substrates (GeneMANIA website) |
Enriched GO biological processes of the phosphorylation target genes of the kinase |
Kinase | GOID | GO term | P.adjust |
PRKD2 | ID | Description | 0.00e+00 |
PRKD2 | GO:0043535 | regulation of blood vessel endothelial cell migration | 4.20e-03 |
PRKD2 | GO:0043534 | blood vessel endothelial cell migration | 4.20e-03 |
PRKD2 | GO:1902903 | regulation of supramolecular fiber organization | 4.20e-03 |
PRKD2 | GO:0043536 | positive regulation of blood vessel endothelial cell migration | 5.49e-03 |
PRKD2 | GO:0010594 | regulation of endothelial cell migration | 5.49e-03 |
PRKD2 | GO:0090049 | regulation of cell migration involved in sprouting angiogenesis | 5.49e-03 |
PRKD2 | GO:0001667 | ameboidal-type cell migration | 5.82e-03 |
PRKD2 | GO:0002042 | cell migration involved in sprouting angiogenesis | 6.55e-03 |
PRKD2 | GO:0110053 | regulation of actin filament organization | 6.55e-03 |
PRKD2 | GO:0043542 | endothelial cell migration | 6.55e-03 |
PRKD2 | GO:1905477 | positive regulation of protein localization to membrane | 6.55e-03 |
PRKD2 | GO:0010632 | regulation of epithelial cell migration | 6.81e-03 |
PRKD2 | GO:0032956 | regulation of actin cytoskeleton organization | 9.96e-03 |
PRKD2 | GO:0010595 | positive regulation of endothelial cell migration | 9.96e-03 |
PRKD2 | GO:0030833 | regulation of actin filament polymerization | 1.06e-02 |
PRKD2 | GO:0090314 | positive regulation of protein targeting to membrane | 1.08e-02 |
PRKD2 | GO:0010631 | epithelial cell migration | 1.08e-02 |
PRKD2 | GO:0090132 | epithelium migration | 1.08e-02 |
PRKD2 | GO:0032970 | regulation of actin filament-based process | 1.08e-02 |
PRKD2 | GO:0090130 | tissue migration | 1.08e-02 |
PRKD2 | GO:0008064 | regulation of actin polymerization or depolymerization | 1.09e-02 |
PRKD2 | GO:0030832 | regulation of actin filament length | 1.10e-02 |
PRKD2 | GO:0051090 | regulation of DNA-binding transcription factor activity | 1.16e-02 |
PRKD2 | GO:0090313 | regulation of protein targeting to membrane | 1.16e-02 |
PRKD2 | GO:0030041 | actin filament polymerization | 1.16e-02 |
PRKD2 | GO:0090050 | positive regulation of cell migration involved in sprouting angiogenesis | 1.18e-02 |
PRKD2 | GO:0010634 | positive regulation of epithelial cell migration | 1.26e-02 |
PRKD2 | GO:1905475 | regulation of protein localization to membrane | 1.32e-02 |
PRKD2 | GO:0002040 | sprouting angiogenesis | 1.46e-02 |
PRKD2 | GO:0007015 | actin filament organization | 1.50e-02 |
PRKD2 | GO:0008154 | actin polymerization or depolymerization | 1.50e-02 |
PRKD2 | GO:0032271 | regulation of protein polymerization | 1.63e-02 |
PRKD2 | GO:0022411 | cellular component disassembly | 1.80e-02 |
PRKD2 | GO:0030838 | positive regulation of actin filament polymerization | 2.00e-02 |
PRKD2 | GO:0007160 | cell-matrix adhesion | 2.36e-02 |
PRKD2 | GO:0051289 | protein homotetramerization | 2.36e-02 |
PRKD2 | GO:0051091 | positive regulation of DNA-binding transcription factor activity | 2.36e-02 |
PRKD2 | GO:0032623 | interleukin-2 production | 2.55e-02 |
PRKD2 | GO:0032663 | regulation of interleukin-2 production | 2.55e-02 |
PRKD2 | GO:0045860 | positive regulation of protein kinase activity | 3.31e-02 |
PRKD2 | GO:0051258 | protein polymerization | 3.36e-02 |
PRKD2 | GO:1903533 | regulation of protein targeting | 3.71e-02 |
PRKD2 | GO:0033627 | cell adhesion mediated by integrin | 4.48e-02 |
PRKD2 | GO:0051262 | protein tetramerization | 4.57e-02 |
PRKD2 | GO:0032273 | positive regulation of protein polymerization | 4.57e-02 |
PRKD2 | GO:0060562 | epithelial tube morphogenesis | 4.57e-02 |
PRKD2 | GO:0032386 | regulation of intracellular transport | 4.57e-02 |
PRKD2 | GO:0033674 | positive regulation of kinase activity | 4.57e-02 |
PRKD2 | GO:0007044 | cell-substrate junction assembly | 4.57e-02 |
Top |
Related Drugs to PRKD2_GLUD1 |
Drugs used for this fusion-positive patient. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Drug | Source | PMID |
Distribution of the number of studies mentioning PRKD2-GLUD1 and kinase inhibitors the PubMed Abstract (04-01-2024) |
Fusion gene - drug pair 1 | Fusion gene - drug pair 2 | PMID | Publication date | DOI | Study title |
Top |
Related Diseases to PRKD2_GLUD1 |
Diseases that have this fusion gene. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Disease | Source | PMID |
Related diseases from the literature mentioned this fusion gene and drug. (PubMed, 04-01-2024) |
MeSH ID | MeSH term |
Diseases associated with fusion partners. (DisGeNet 4.0) |
Partner | Gene | Disease ID | Disease name | # pubmeds | Source |
Top |
Clinical Trials of the Found Drugs/Small Molecules |
Statistics of the Clinical Trials of the Found Kinase Inibitors from clinicaltrials.gov (06-17-2024) |
Clinical Trials from clinicaltrials.gov (06-17-2024) |
Fusion Gene | Kinase Inhibitor | NCT ID | Study Status | Phases | Disease | # Enrolment | Date |