UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
|
Kinase Fusion Gene:ATXN7L1_EGFR |
Kinase Fusion Protein Summary |
Kinase Fusion gene summary |
Kinase Fusion partner gene information | Kinase Fusion gene name: ATXN7L1_EGFR | KinaseFusionDB ID: KFG511 | FusionGDB2.0 ID: KFG511 | Hgene | Tgene | Gene symbol | ATXN7L1 | EGFR | Gene ID | 222255 | 1956 | |
Gene name | ataxin 7 like 1 | epidermal growth factor receptor | ||||||||||
Synonyms | ATXN7L4 | ERBB|ERBB1|ERRP|HER1|NISBD2|PIG61|mENA | ||||||||||
Cytomap | 7q22.3 | 7p11.2 | ||||||||||
Type of gene | protein-coding | protein-coding | ||||||||||
Description | ataxin-7-like protein 1ataxin 7-like 4ataxin-7-like protein 4 | epidermal growth factor receptorEGFR vIIIavian erythroblastic leukemia viral (v-erb-b) oncogene homologcell growth inhibiting protein 40cell proliferation-inducing protein 61epidermal growth factor receptor tyrosine kinase domainerb-b2 receptor tyro | ||||||||||
Modification date | 20240305 | 20240416 | ||||||||||
UniProtAcc | Q9ULK2 | P00533 | ||||||||||
Ensembl transtripts involved in fusion gene | ENST ids | ENST00000318724, ENST00000419735, ENST00000388807, ENST00000472910, ENST00000477775, ENST00000478915, | ENST00000454757, ENST00000463948, ENST00000275493, ENST00000342916, ENST00000344576, ENST00000420316, ENST00000442591, ENST00000455089, | |||||||||
Context (manual curation of fusion genes in KinaseFusionDB) | PubMed: ATXN7L1 [Title/Abstract] AND EGFR [Title/Abstract] AND fusion [Title/Abstract] | |||||||||||
Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) | ATXN7L1(105516257)-EGFR(55209978), # samples:1 EGFR(55269475)-ATXN7L1(105251050), # samples:1 |
Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
Partner | Gene | GO ID | GO term | PubMed ID |
Tgene | EGFR | GO:0001934 | positive regulation of protein phosphorylation | 20551055 |
Tgene | EGFR | GO:0007165 | signal transduction | 10572067 |
Tgene | EGFR | GO:0007166 | cell surface receptor signaling pathway | 7736574 |
Tgene | EGFR | GO:0007173 | epidermal growth factor receptor signaling pathway | 7736574 |
Tgene | EGFR | GO:0007173 | epidermal growth factor receptor signaling pathway | 9890893|12435727|12828935 |
Tgene | EGFR | GO:0008284 | positive regulation of cell population proliferation | 7736574 |
Tgene | EGFR | GO:0018108 | peptidyl-tyrosine phosphorylation | 22732145 |
Tgene | EGFR | GO:0030307 | positive regulation of cell growth | 15467833 |
Tgene | EGFR | GO:0038134 | ERBB2-EGFR signaling pathway | 11336639 |
Tgene | EGFR | GO:0042177 | negative regulation of protein catabolic process | 17115032 |
Tgene | EGFR | GO:0042327 | positive regulation of phosphorylation | 15082764 |
Tgene | EGFR | GO:0043406 | positive regulation of MAP kinase activity | 10572067 |
Tgene | EGFR | GO:0045739 | positive regulation of DNA repair | 17115032 |
Tgene | EGFR | GO:0045740 | positive regulation of DNA replication | 17115032 |
Tgene | EGFR | GO:0045944 | positive regulation of transcription by RNA polymerase II | 20551055 |
Tgene | EGFR | GO:0050679 | positive regulation of epithelial cell proliferation | 10572067 |
Tgene | EGFR | GO:0070141 | response to UV-A | 18483258 |
Tgene | EGFR | GO:0070374 | positive regulation of ERK1 and ERK2 cascade | 20551055 |
Tgene | EGFR | GO:0071392 | cellular response to estradiol stimulus | 20551055 |
Tgene | EGFR | GO:1900020 | positive regulation of protein kinase C activity | 22732145 |
Tgene | EGFR | GO:1903078 | positive regulation of protein localization to plasma membrane | 22732145 |
Kinase Fusion gene breakpoints across ATXN7L1 (5'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Kinase Fusion gene breakpoints across EGFR (3'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Top |
Kinase Fusion Gene Sample Information |
Kinase Fusion gene information. |
Kinase Fusion gene information from four resources (ChiTars 5.0, ChimerDB 4.0, COSMIC, and CCLE) * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
Source | Sample | Hgene | Hchr | Hbp | Tgene | Tchr | Tbp |
ChimerDB4 | TCGA-VQ-AA6I | ATXN7L1 | chr7 | 105516257 | EGFR | chr7 | 55209978 |
Top |
Kinase Fusion ORF Analysis |
Kinase Fusion information from ORFfinder translation from full-length transcript sequence from KinaseFusionDB. |
Henst | Tenst | Hgene | Hchr | Hbp | Tgene | Tchr | Tbp | Seq length (transcript) | Seq length (amino acids) |
ENST00000419735 | ENST00000455089 | ATXN7L1 | chr7 | 105516257 | EGFR | chr7 | 55209978 | 3795 | 1145 |
Top |
Kinase Fusion Amino Acid Sequences |
For individual full-length fusion transcript sequence from KinaseFusionDB, we ran ORFfinder and chose the longest ORF among the all predicted ones. |
>Henst_Tenst_Hgene_Hchr_Hbp_Tgene_Tchr_Tbp_length(fusion AA)_AAseq >ENST00000419735_ENST00000455089_ATXN7L1_chr7_105516257_EGFR_chr7_55209978_length(amino acids)=1145 MTSERSRIPCLSAAAAEGTGKKQQEGRAMATLDRKVPSPEAFLGKPWSSWIDAAKLHCSDNVDLEEAGKEGGKSREVMRLNKEVCQGTSN KLTQLGTFEDHFLSLQRMFNNCEVVLGNLEITYVQRNYDLSFLKTIQEVAGYVLIALNTVERIPLENLQIIRGNMYYENSYALAVLSNYD ANKTGLKELPMRNLQGQKCDPSCPNGSCWGAGEENCQKLTKIICAQQCSGRCRGKSPSDCCHNQCAAGCTGPRESDCLVCRKFRDEATCK DTCPPLMLYNPTTYQMDVNPEGKYSFGATCVKKCPRNYVVTDHGSCVRACGADSYEMEEDGVRKCKKCEGPCRKVCNGIGIGEFKDSLSI NATNIKHFKNCTSISGDLHILPVAFRGDSFTHTPPLDPQELDILKTVKEITGFLLIQAWPENRTDLHAFENLEIIRGRTKQHGQFSLAVV SLNITSLGLRSLKEISDGDVIISGNKNLCYANTINWKKLFGTSGQKTKIISNRGENSCKATGQVCHALCSPEGCWGPEPRDCVSCRNVSR GRECVDKCNLLEGEPREFVENSECIQCHPECLPQAMNITCTGRGPDNCIQCAHYIDGPHCVKTCPAGVMGENNTLVWKYADAGHVCHLCH PNCTYGCTGPGLEGCPTNGPKIPSIATGMVGALLLLLVVALGIGLFMRRRHIVRKRTLRRLLQERELVEPLTPSGEAPNQALLRILKETE FKKIKVLGSGAFGTVYKGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMASVDNPHVCRLLGICLTSTVQLITQLMPFGCLLDY VREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKITDFGLAKLLGAEEKEYHAEGGKVPIKWMALESILHRIY THQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGERLPQPPICTIDVYMIMVKCWMIDADSRPKFRELIIEFSKMARDPQRYLVI QGDERMHLPSPTDSNFYRALMDEEDMDDVVDADEYLIPQQGFFSSPSTSRTPLLSSLSATSNNSTVACIDRNGLQSCPIKEDSFLQRYSS -------------------------------------------------------------- |
Multiple Sequence Alignment of All Fusion Protein Isoforms |
Top |
Kinase Fusion Protein Functional Features |
Four levels of functional features of fusion genes Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr7:105516257/chr7:55209978) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
Main function of each fusion partner protein. (from UniProt) |
Hgene | Tgene |
ATXN7L1 | EGFR |
FUNCTION: Receptor tyrosine kinase binding ligands of the EGF family and activating several signaling cascades to convert extracellular cues into appropriate cellular responses (PubMed:2790960, PubMed:10805725, PubMed:27153536). Known ligands include EGF, TGFA/TGF-alpha, AREG, epigen/EPGN, BTC/betacellulin, epiregulin/EREG and HBEGF/heparin-binding EGF (PubMed:2790960, PubMed:7679104, PubMed:8144591, PubMed:9419975, PubMed:15611079, PubMed:12297049, PubMed:27153536, PubMed:20837704, PubMed:17909029). Ligand binding triggers receptor homo- and/or heterodimerization and autophosphorylation on key cytoplasmic residues. The phosphorylated receptor recruits adapter proteins like GRB2 which in turn activates complex downstream signaling cascades. Activates at least 4 major downstream signaling cascades including the RAS-RAF-MEK-ERK, PI3 kinase-AKT, PLCgamma-PKC and STATs modules (PubMed:27153536). May also activate the NF-kappa-B signaling cascade (PubMed:11116146). Also directly phosphorylates other proteins like RGS16, activating its GTPase activity and probably coupling the EGF receptor signaling to the G protein-coupled receptor signaling (PubMed:11602604). Also phosphorylates MUC1 and increases its interaction with SRC and CTNNB1/beta-catenin (PubMed:11483589). Positively regulates cell migration via interaction with CCDC88A/GIV which retains EGFR at the cell membrane following ligand stimulation, promoting EGFR signaling which triggers cell migration (PubMed:20462955). Plays a role in enhancing learning and memory performance (By similarity). Plays a role in mammalian pain signaling (long-lasting hypersensitivity) (By similarity). {ECO:0000250|UniProtKB:Q01279, ECO:0000269|PubMed:10805725, ECO:0000269|PubMed:11116146, ECO:0000269|PubMed:11483589, ECO:0000269|PubMed:11602604, ECO:0000269|PubMed:12297049, ECO:0000269|PubMed:12297050, ECO:0000269|PubMed:12620237, ECO:0000269|PubMed:12873986, ECO:0000269|PubMed:15374980, ECO:0000269|PubMed:15590694, ECO:0000269|PubMed:15611079, ECO:0000269|PubMed:17115032, ECO:0000269|PubMed:17909029, ECO:0000269|PubMed:19560417, ECO:0000269|PubMed:20462955, ECO:0000269|PubMed:20837704, ECO:0000269|PubMed:21258366, ECO:0000269|PubMed:27153536, ECO:0000269|PubMed:2790960, ECO:0000269|PubMed:7679104, ECO:0000269|PubMed:8144591, ECO:0000269|PubMed:9419975}.; FUNCTION: Isoform 2 may act as an antagonist of EGF action.; FUNCTION: (Microbial infection) Acts as a receptor for hepatitis C virus (HCV) in hepatocytes and facilitates its cell entry. Mediates HCV entry by promoting the formation of the CD81-CLDN1 receptor complexes that are essential for HCV entry and by enhancing membrane fusion of cells expressing HCV envelope glycoproteins. {ECO:0000269|PubMed:21516087}. |
Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
- Retained domain in the 5'-partner of fusion protein (protein functional feature from UniProt). |
Partner | Hgeneene | Hbp | Tgeneene | Tbp | ENST | BPexon | TotalExon | Protein feature loci | BPloci | TotalLen | Feature | Note |
- Retained domain in the 3'-partner of fusion protein (protein functional feature from UniProt). |
Partner | Hgeneene | Hbp | Tgeneene | Tbp | ENST | BPexon | TotalExon | Protein feature loci | BPloci | TotalLen | Feature | Note |
Tgene | ATXN7L1 | 105516257 | EGFR | 55209978 | ENST00000419735 | 0 | 10 | 712_979 | 29 | 406 | Domain | Note=Protein kinase;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00159 |
Tgene | ATXN7L1 | 105516257 | EGFR | 55209978 | ENST00000419735 | 0 | 16 | 712_979 | 29 | 629 | Domain | Note=Protein kinase;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00159 |
Tgene | ATXN7L1 | 105516257 | EGFR | 55209978 | ENST00000419735 | 0 | 16 | 712_979 | 29 | 706 | Domain | Note=Protein kinase;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00159 |
Tgene | ATXN7L1 | 105516257 | EGFR | 55209978 | ENST00000419735 | 0 | 28 | 712_979 | 29 | 1211 | Domain | Note=Protein kinase;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00159 |
Top |
Kinase Fusion Protein Structures |
CIF files of the predicted kinase fusion proteins * Here we show the 3D structure of the fusion proteins using Mol*. AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Model confidence is shown from the pLDDT values per residue. pLDDT corresponds to the model’s prediction of its score on the local Distance Difference Test. It is a measure of local accuracy (from AlphfaFold website). To color code individual residues, we transformed individual PDB files into CIF format. |
Kinase Fusion protein CIF link (fusion AA seq ID in KinaseFusionDB) | Henst | Tenst | Hgene | Hchr | Hbp | Tgene | Tchr | Tbp | AA seq | Len(AA seq) |
PDB file >>>44_ATXN7L1_EGFR | ENST00000419735 | ENST00000455089 | ATXN7L1 | chr7 | 105516257 | EGFR | chr7 | 55209978 | MTSERSRIPCLSAAAAEGTGKKQQEGRAMATLDRKVPSPEAFLGKPWSSWIDAAKLHCSDNVDLEEAGKEGGKSREVMRLNKEVCQGTSN KLTQLGTFEDHFLSLQRMFNNCEVVLGNLEITYVQRNYDLSFLKTIQEVAGYVLIALNTVERIPLENLQIIRGNMYYENSYALAVLSNYD ANKTGLKELPMRNLQGQKCDPSCPNGSCWGAGEENCQKLTKIICAQQCSGRCRGKSPSDCCHNQCAAGCTGPRESDCLVCRKFRDEATCK DTCPPLMLYNPTTYQMDVNPEGKYSFGATCVKKCPRNYVVTDHGSCVRACGADSYEMEEDGVRKCKKCEGPCRKVCNGIGIGEFKDSLSI NATNIKHFKNCTSISGDLHILPVAFRGDSFTHTPPLDPQELDILKTVKEITGFLLIQAWPENRTDLHAFENLEIIRGRTKQHGQFSLAVV SLNITSLGLRSLKEISDGDVIISGNKNLCYANTINWKKLFGTSGQKTKIISNRGENSCKATGQVCHALCSPEGCWGPEPRDCVSCRNVSR GRECVDKCNLLEGEPREFVENSECIQCHPECLPQAMNITCTGRGPDNCIQCAHYIDGPHCVKTCPAGVMGENNTLVWKYADAGHVCHLCH PNCTYGCTGPGLEGCPTNGPKIPSIATGMVGALLLLLVVALGIGLFMRRRHIVRKRTLRRLLQERELVEPLTPSGEAPNQALLRILKETE FKKIKVLGSGAFGTVYKGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMASVDNPHVCRLLGICLTSTVQLITQLMPFGCLLDY VREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKITDFGLAKLLGAEEKEYHAEGGKVPIKWMALESILHRIY THQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGERLPQPPICTIDVYMIMVKCWMIDADSRPKFRELIIEFSKMARDPQRYLVI QGDERMHLPSPTDSNFYRALMDEEDMDDVVDADEYLIPQQGFFSSPSTSRTPLLSSLSATSNNSTVACIDRNGLQSCPIKEDSFLQRYSS | 1145 |
3D view using mol* of 44_ATXN7L1_EGFR | ||||||||||
PDB file >>>TKFP_65_ATXN7L1_EGFR | ENST00000419735 | ENST00000455089 | ATXN7L1 | chr7 | 105516257 | EGFR | chr7 | 55209978 | MTSERSRIPCLSAAAAEGTGKKQQEGRAMATLDRKVPSPEAFLGKPWSSWIDAAKLHCSDNVDLEEAGKEGGKSREVMRLNKEVCQGTSN KLTQLGTFEDHFLSLQRMFNNCEVVLGNLEITYVQRNYDLSFLKTIQEVAGYVLIALNTVERIPLENLQIIRGNMYYENSYALAVLSNYD ANKTGLKELPMRNLQGQKCDPSCPNGSCWGAGEENCQKLTKIICAQQCSGRCRGKSPSDCCHNQCAAGCTGPRESDCLVCRKFRDEATCK DTCPPLMLYNPTTYQMDVNPEGKYSFGATCVKKCPRNYVVTDHGSCVRACGADSYEMEEDGVRKCKKCEGPCRKVCNGIGIGEFKDSLSI NATNIKHFKNCTSISGDLHILPVAFRGDSFTHTPPLDPQELDILKTVKEITGFLLIQAWPENRTDLHAFENLEIIRGRTKQHGQFSLAVV SLNITSLGLRSLKEISDGDVIISGNKNLCYANTINWKKLFGTSGQKTKIISNRGENSCKATGQVCHALCSPEGCWGPEPRDCVSCRNVSR GRECVDKCNLLEGEPREFVENSECIQCHPECLPQAMNITCTGRGPDNCIQCAHYIDGPHCVKTCPAGVMGENNTLVWKYADAGHVCHLCH PNCTYGCTGPGLEGCPTNGPKIPSIATGMVGALLLLLVVALGIGLFMRRRHIVRKRTLRRLLQERELVEPLTPSGEAPNQALLRILKETE FKKIKVLGSGAFGTVYKGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMASVDNPHVCRLLGICLTSTVQLITQLMPFGCLLDY VREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKITDFGLAKLLGAEEKEYHAEGGKVPIKWMALESILHRIY THQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGERLPQPPICTIDVYMIMVKCWMIDADSRPKFRELIIEFSKMARDPQRYLVI QGDERMHLPSPTDSNFYRALMDEEDMDDVVDADEYLIPQQGFFSSPSTSRTPLLSSLSATSNNSTVACIDRNGLQSCPIKEDSFLQRYSS | 1145_ATXN7L1_EGFR |
Top |
Comparison of Fusion Protein Isoforms |
Superimpose the 3D Structures Among All Fusion Protein Isoforms * Download the pdb file and open it from the molstar online viewer. |
Comparison of the Secondary Structures of Fusion Protein Isoforms |
Top |
Comparison of Fusion Protein Sequences/Structures with Known Sequences/Structures from PDB |
Top |
pLDDT score distribution |
pLDDT score distribution of the predicted fusion protein structures from AlphaFold2 * AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. * The blue color at the bottom marks the best active site residues. |
44_ATXN7L1_EGFR.png |
44_ATXN7L1_EGFR.png |
Top |
Potential Active Site Information |
The potential binding sites of these fusion proteins were identified using SiteMap, a module of the Schrodinger suite. |
Kinase Fusion AA seq ID in KinaseFusionDB | Site score | Size | Dscore | Volume | Exposure | Enclosure | Contact | Phobic | Philic | Balance | Don/Acc | Residues |
Top |
Ramachandran Plot of Kinase Fusion Protein Structure |
Ramachandran plot of the torsional angles - phi (φ)and psi (ψ) - of the residues (amino acids) contained in this fusion protein peptide. |
44_ATXN7L1_EGFR_ramachandran.png |
Top |
Virtual Screening Results |
Distribution of the average docking score across all approved kinase inhibitors. Distribution of the number of occurrence across all approved kinase inhibitors. |
5'-kinase fusion protein case |
3'-kinase fusion protein case |
Top |
Drug information from DrugBank of the top 20 interacting small molecules. * The detailed information of individual kinase inhibitors are available in the download page. |
Fusion gene name info | Drug | Docking score | Glide g score | Glide energy |
44_ATXN7L1_EGFR-DOCK_HTVS_1-001 | Afatinib | -7.19137 | -7.37367 | -57.5598 |
44_ATXN7L1_EGFR-DOCK_HTVS_1-001 | Afatinib | -7.19137 | -7.37367 | -57.5598 |
44_ATXN7L1_EGFR-DOCK_HTVS_1-001 | Afatinib | -7.18997 | -7.37367 | -57.5598 |
44_ATXN7L1_EGFR-DOCK_HTVS_1-001 | Larotrectinib | -6.71092 | -6.71092 | -52.8018 |
44_ATXN7L1_EGFR-DOCK_HTVS_1-001 | Afatinib | -6.5134099999999995 | -6.695710000000001 | -55.3131 |
44_ATXN7L1_EGFR-DOCK_HTVS_1-001 | Afatinib | -6.5134099999999995 | -6.695710000000001 | -55.3131 |
44_ATXN7L1_EGFR-DOCK_HTVS_1-001 | Afatinib | -6.51201 | -6.695710000000001 | -55.3131 |
44_ATXN7L1_EGFR-DOCK_HTVS_1-001 | Tepotinib | -6.4798599999999995 | -6.48096 | -53.8599 |
44_ATXN7L1_EGFR-DOCK_HTVS_1-001 | Cobimetinib | -6.3688199999999995 | -6.37162 | -51.1501 |
44_ATXN7L1_EGFR-DOCK_HTVS_1-001 | Lapatinib | -6.28699 | -6.37579 | -64.2696 |
44_ATXN7L1_EGFR-DOCK_HTVS_1-001 | Lapatinib | -6.23914 | -6.32794 | -60.3626 |
44_ATXN7L1_EGFR-DOCK_HTVS_1-001 | Neratinib | -6.06114 | -6.24704 | -50.1666 |
44_ATXN7L1_EGFR-DOCK_HTVS_1-001 | Cabozantinib | -6.00024 | -6.04524 | -45.9307 |
44_ATXN7L1_EGFR-DOCK_HTVS_1-001 | Cabozantinib | -6.00024 | -6.04524 | -45.9307 |
44_ATXN7L1_EGFR-DOCK_HTVS_1-001 | Neratinib | -5.77489 | -5.95719 | -46.4382 |
44_ATXN7L1_EGFR-DOCK_HTVS_1-001 | Neratinib | -5.77489 | -5.95719 | -46.4382 |
44_ATXN7L1_EGFR-DOCK_HTVS_1-001 | Afatinib | -5.6504199999999996 | -5.83272 | -55.397 |
44_ATXN7L1_EGFR-DOCK_HTVS_1-001 | Afatinib | -5.6504199999999996 | -5.83272 | -55.397 |
44_ATXN7L1_EGFR-DOCK_HTVS_1-001 | Afatinib | -5.64902 | -5.83272 | -55.397 |
44_ATXN7L1_EGFR-DOCK_HTVS_1-001 | Netarsudil | -5.64576 | -5.65686 | -57.808 |
Top |
Kinase-Substrate Information of ATXN7L1_EGFR |
Phosphorylation target of the kinase (phosphosite, 03-17-2024) |
Kinase | Kinase UniProt Acc | Kinase species | Substrate | Substrate UniProt Acc | Substrate phosphorylated residues | Substrate phosphorylated sites (+/-7AA) | Domain |
EGFR | P00533 | human | GNAI1 | P63096 | Y320 | RKDTkEIyTHFTCAT | G-alpha |
EGFR | P00533 | human | GSTP1 | P09211 | Y8 | MPPyTVVyFPVRGRC | GST_N |
EGFR | P00533 | human | SHC1 | P29353-3 | Y194 | EEPPDHQyyNDFPGK | |
EGFR | P00533 | human | GSTP1 | P09211 | Y4 | ____MPPyTVVyFPV | GST_N |
EGFR | P00533 | human | SHC1 | P29353-3 | Y272 | ELFDDPSyVNVQNLD | |
EGFR | P00533 | human | VAV2 | P52735 | Y172 | EDGGDDIyEDIIKVE | |
EGFR | P00533 | human | CTNNB1 | P35222 | Y142 | AVVNLINyQDDAELA | |
EGFR | P00533 | human | SHC1 | P29353-2 | Y239 | EEPPDHQyyNDFPGK | |
EGFR | P00533 | human | GAB1 | Q13480 | Y406 | DAssQDCyDIPRAFP | |
EGFR | P00533 | human | PELI1 | Q96FA3 | T264 | EGLSHTPtVkHLEAL | |
EGFR | P00533 | human | BECN1 | Q14457 | Y233 | EAQyQREysEFkRQQ | APG6_N |
EGFR | P00533 | human | GPRC5A | Q8NFJ5 | Y350 | WPsPykDyEVkKEGs | |
EGFR | P00533 | human | SQSTM1 | Q13501 | Y433 | AALDtIQyskHPPPL | UBA_5 |
EGFR | P00533 | human | SCD | O00767 | Y14 | QDDISSSyTTTTTIT | |
EGFR | P00533 | human | ANXA1 | P04083 | Y21 | IENEEQEyVQtVkss | |
EGFR | P00533 | human | SCD | O00767 | Y55 | PDIkDDIyDPTykDk | |
EGFR | P00533 | human | HIP1 | O00291 | Y152 | LLRTKMEyHTkNPRF | ANTH |
EGFR | P00533 | human | BECN1 | Q14457 | Y229 | LDQEEAQyQREysEF | APG6_N |
EGFR | P00533 | human | PTPN1 | P18031 | Y66 | LHQEDNDyINAsLIk | Y_phosphatase |
EGFR | P00533 | human | EGFR | P00533 | Y1092 | tFLPVPEyINQsVPk | |
EGFR | P00533 | human | GAB1 | Q13480 | Y659 | VADERVDyVVVDQQK | |
EGFR | P00533 | human | SHC1 | P29353-2 | Y240 | EPPDHQyyNDFPGKE | |
EGFR | P00533 | human | GAB1 | Q13480 | Y373 | AsDtDssyCIPTAGM | |
EGFR | P00533 | human | SHC3 | Q92529-2 | Y218 | GDGSDHPyyNSIPSK | |
EGFR | P00533 | human | KCNJ4 | P48050 | Y234 | YMTQEGEyLPLDQRD | IRK_C |
EGFR | P00533 | human | GAB1 | Q13480 | Y589 | SHDSEENyVPMNPNL | |
EGFR | P00533 | human | SHC3 | Q92529-2 | Y256 | FAGKEQTyyQGRHLG | |
EGFR | P00533 | human | PPP2CA | P67775 | Y307 | VTRRtPDyFl_____ | |
EGFR | P00533 | human | PKM | P14618 | Y148 | kItLDNAyMEkCDEN | PK |
EGFR | P00533 | human | USP8 | P40818 | Y810 | DYFNRNCyQDDINRS | UCH |
EGFR | P00533 | human | ASAP3 | Q8TDY4 | Y34 | FAAKMPRyRGAALAR | BAR_3 |
EGFR | P00533 | human | GNAI1 | P63096 | Y155 | LNDSAAyyLNDLDRI | G-alpha |
EGFR | P00533 | human | PELI1 | Q96FA3 | Y154 | PPFTARIyAAGFDSS | Pellino |
EGFR | P00533 | human | EGFR | P00533 | Y1110 | GsVQNPVyHNQPLNP | |
EGFR | P00533 | human | KCNN1 | Q92952 | Y109 | KRKRLsDyALIFGMF | SK_channel |
EGFR | P00533 | human | CCDC88A | Q3V6T2 | Y1799 | QSkDsNPyAtLPRAS | |
EGFR | P00533 | human | EGFR | P00533 | Y1197 | stAENAEyLRVAPQS | |
EGFR | P00533 | human | AGO2 | Q9UKV8 | Y393 | AsFNtDPyVREFGIM | ArgoL2 |
EGFR | P00533 | human | PRKDC | P78527 | T2609 | LtPMFVEtQAsQGtL | DNAPKcs_CC5 |
EGFR | P00533 | human | VAV2 | P52735 | Y142 | TENDDDVyRSLEELA | |
EGFR | P00533 | human | GPRC5A | Q8NFJ5 | Y320 | GDtLyAPystHFQLQ | |
EGFR | P00533 | human | PFKP | Q01813 | Y64 | VYFIYEGyQGMVDGG | PFK |
EGFR | P00533 | human | SHC1 | P29353-2 | Y317 | ELFDDPSyVNVQNLD | |
EGFR | P00533 | human | STING1 | Q86WV6 | Y245 | RVysNSIyELLENGQ | TMEM173 |
EGFR | P00533 | human | CCDC50 | Q8IVM0 | Y304 | SSHkGFHyKH_____ | |
EGFR | P00533 | human | EGFR | P00533 | Y1016 | DVVDADEyLIPQQGF | |
EGFR | P00533 | human | ESR1 | P03372 | S118 | LHPPPQLsPFLQPHG | Oest_recep |
EGFR | P00533 | human | PLCG1 | P19174 | Y771 | IGtAEPdyGALyEGR | |
EGFR | P00533 | human | PTK2 | Q05397 | Y5 | ___MAAAyLDPNLNH | |
EGFR | P00533 | human | PCNA | P12004 | Y211 | QLTFALryLNFFtkA | PCNA_C |
EGFR | P00533 | human | SPRED1 | Q7Z699 | S105 | KFGLTFQsPADARAF | WH1 |
EGFR | P00533 | human | PLD2 | O14939 | Y296 | LILkCSSyRQARWWA | |
EGFR | P00533 | human | USP8 | P40818 | Y717 | PsKLKRsyssPDItQ | |
EGFR | P00533 | human | SCD | O00767 | Y41 | kLETMPLyLEDDIRP | |
EGFR | P00533 | human | EGFR | P00533 | Y869 | LGAEEkEyHAEGGkV | PK_Tyr_Ser-Thr |
EGFR | P00533 | human | VAV2 | P52735 | Y159 | HDLGEDIyDCVPCED | |
EGFR | P00533 | human | BECN1 | Q14457 | Y352 | KSKELPLyCSGGLRF | APG6 |
EGFR | P00533 | human | EPB41 | P11171-4 | Y418 | RLDGENIyIRHSNLM | |
EGFR | P00533 | human | GAB1 | Q13480 | Y447 | SEELDENyVPMNPNs | |
EGFR | P00533 | human | GAB1 | Q13480 | Y472 | EPIQEANyVPMtPGT | |
EGFR | P00533 | human | SHC1 | P29353-3 | Y195 | EPPDHQyyNDFPGKE | |
EGFR | P00533 | human | NIBAN2 | Q96TA1 | Y593 | PIDWGEEysNSGGGG | |
EGFR | P00533 | human | HDAC6 | Q9UBN7 | Y570 | SSNFDSIyICPSTFA | Hist_deacetyl |
EGFR | P00533 | human | LRRK1 | Q38SD2 | Y971 | TQQTEEQyFQFLAKF | COR |
EGFR | P00533 | human | ATM | Q13315 | Y370 | SLEIsQSyTttQRES | |
EGFR | P00533 | human | PDP1 | Q9P0J1 | Y381 | DQLNDNEyTkFIPPN | PP2C |
EGFR | P00533 | human | PLCG1 | P19174 | Y783 | EGRNPGFyVEANPMP | |
EGFR | P00533 | human | HDAC1 | Q13547 | Y72 | TkYHSDDyIkFLRSI | Hist_deacetyl |
EGFR | P00533 | human | TLR3 | O15455 | Y858 | FLEEIPDyKLNHALC | TIR |
EGFR | P00533 | human | ABCA1 | O95477 | S2054 | GGNkRKLsTAMALIG | ABC_tran |
EGFR | P00533 | human | RGS16 | O15492 | Y168 | TLMEKDSyPRFLkSP | RGS |
EGFR | P00533 | human | GNAI1 | P63096 | Y154 | QLNDSAAyyLNDLDR | G-alpha |
EGFR | P00533 | human | PTK2 | Q05397 | Y194 | ALEKKSNyEVLEkDV | FERM_M |
EGFR | P00533 | human | CTNNB1 | P35222 | Y654 | RNEGVAtyAAAVLFR | |
EGFR | P00533 | human | CCDC88C | Q9P219 | Y2025 | PQTVWyEyGCV____ | |
EGFR | P00533 | human | EZR | P15311 | Y354 | LMLRLQDyEEktKKA | ERM_helical |
EGFR | P00533 | human | TRIP13 | Q15645 | Y206 | RLSSRYRyGQLIEIN | AAA |
EGFR | P00533 | human | LYN | P07948 | Y32 | RNTERtIyVRDPTSN | |
EGFR | P00533 | human | GAB1 | Q13480 | Y285 | TEADGELyVFNTPSG | |
EGFR | P00533 | human | GSTP1 | P09211 | Y199 | AFLAsPEyVNLPING | |
EGFR | P00533 | human | CCDC50 | Q8IVM0 | Y279 | tDGEDADytHFtNQQ | |
EGFR | P00533 | human | SOX2 | P48431 | Y277 | LRDMISMyLPGAEVP | |
EGFR | P00533 | human | IKBKE | Q14164 | Y179 | sVYGTEEyLHPDMYE | Pkinase |
EGFR | P00533 | human | KCND3 | Q9UK17 | Y136 | GDCCYEEyKDRKREN | |
EGFR | P00533 | human | GPRC5A | Q8NFJ5 | Y317 | EEtGDtLyAPystHF | |
EGFR | P00533 | human | CCDC88A | Q3V6T2 | Y1765 | PRktEDtyFISSAGk | |
EGFR | P00533 | human | CCDC50 | Q8IVM0 | Y217 | MAEEkKAykkAkERE | |
EGFR | P00533 | human | GPRC5A | Q8NFJ5 | Y347 | AHAWPsPykDyEVkK | |
EGFR | P00533 | human | SHC3 | Q92529-2 | Y301 | PTGEAPTyVNTQQIP | |
EGFR | P00533 | human | EZR | P15311 | Y146 | kEVHksGyLSsERLI | FERM_M |
EGFR | P00533 | human | MYL12A | P19105 | Y155 | DkkGNFNyIEFTRIL | EF-hand_11 |
EGFR | P00533 | human | SHC3 | Q92529-2 | Y257 | AGKEQTyyQGRHLGD | |
EGFR | P00533 | human | PPARD | Q03181 | Y108 | TIRMKLEyEKCERSC | zf-C4 |
EGFR | P00533 | human | SHC3 | Q92529-2 | Y283 | RQGSSDIySTPEGKL | |
EGFR | P00533 | human | PPARG | P37231-2 | Y74 | YDLKLQEyQSAIkVE | PPARgamma_N |
EGFR | P00533 | human | SHC3 | Q92529-2 | Y219 | DGSDHPyyNSIPSKM | |
EGFR | P00533 | human | EGFR | P00533 | Y1172 | IsLDNPDyQQDFFPk | |
EGFR | P00533 | human | GAB1 | Q13480 | Y627 | KGDKQVEyLDLDLDs | |
EGFR | P00533 | human | TRIP13 | Q15645 | Y56 | HNIVFGDyTWTEFDE | |
EGFR | P00533 | human | IKBKE | Q14164 | Y153 | GEEGQSIykLTDFGA | Pkinase |
Biological Network Integration of This Kinase and Substrates (GeneMANIA website) |
Enriched GO biological processes of the phosphorylation target genes of the kinase |
Kinase | GOID | GO term | P.adjust |
EGFR | ID | Description | 0.00e+00 |
EGFR | GO:0007173 | epidermal growth factor receptor signaling pathway | 4.35e-08 |
EGFR | GO:0038127 | ERBB signaling pathway | 8.30e-08 |
EGFR | GO:0031400 | negative regulation of protein modification process | 2.28e-06 |
EGFR | GO:0002757 | immune response-activating signaling pathway | 4.65e-05 |
EGFR | GO:0000302 | response to reactive oxygen species | 5.39e-05 |
EGFR | GO:0002764 | immune response-regulating signaling pathway | 5.43e-05 |
EGFR | GO:0001933 | negative regulation of protein phosphorylation | 6.14e-05 |
EGFR | GO:0034614 | cellular response to reactive oxygen species | 6.63e-05 |
EGFR | GO:0045088 | regulation of innate immune response | 6.63e-05 |
EGFR | GO:0050727 | regulation of inflammatory response | 6.63e-05 |
EGFR | GO:0043434 | response to peptide hormone | 6.63e-05 |
EGFR | GO:0042326 | negative regulation of phosphorylation | 6.63e-05 |
EGFR | GO:0038093 | Fc receptor signaling pathway | 9.66e-05 |
EGFR | GO:0045765 | regulation of angiogenesis | 9.66e-05 |
EGFR | GO:0030522 | intracellular receptor signaling pathway | 9.66e-05 |
EGFR | GO:1901342 | regulation of vasculature development | 9.66e-05 |
EGFR | GO:0043122 | regulation of canonical NF-kappaB signal transduction | 1.06e-04 |
EGFR | GO:0002433 | immune response-regulating cell surface receptor signaling pathway involved in phagocytosis | 1.06e-04 |
EGFR | GO:0038096 | Fc-gamma receptor signaling pathway involved in phagocytosis | 1.06e-04 |
EGFR | GO:0045936 | negative regulation of phosphate metabolic process | 1.24e-04 |
EGFR | GO:0010563 | negative regulation of phosphorus metabolic process | 1.24e-04 |
EGFR | GO:0002431 | Fc receptor mediated stimulatory signaling pathway | 2.02e-04 |
EGFR | GO:0007249 | canonical NF-kappaB signal transduction | 2.02e-04 |
EGFR | GO:1904377 | positive regulation of protein localization to cell periphery | 2.02e-04 |
EGFR | GO:0038094 | Fc-gamma receptor signaling pathway | 2.17e-04 |
EGFR | GO:0071375 | cellular response to peptide hormone stimulus | 2.34e-04 |
EGFR | GO:0070373 | negative regulation of ERK1 and ERK2 cascade | 2.34e-04 |
EGFR | GO:0010887 | negative regulation of cholesterol storage | 2.92e-04 |
EGFR | GO:0072697 | protein localization to cell cortex | 2.92e-04 |
EGFR | GO:0006909 | phagocytosis | 3.76e-04 |
EGFR | GO:0030111 | regulation of Wnt signaling pathway | 3.76e-04 |
EGFR | GO:0045089 | positive regulation of innate immune response | 4.05e-04 |
EGFR | GO:0034599 | cellular response to oxidative stress | 5.35e-04 |
EGFR | GO:0050673 | epithelial cell proliferation | 5.35e-04 |
EGFR | GO:0061912 | selective autophagy | 5.35e-04 |
EGFR | GO:0060828 | regulation of canonical Wnt signaling pathway | 5.98e-04 |
EGFR | GO:0002833 | positive regulation of response to biotic stimulus | 5.98e-04 |
EGFR | GO:1901653 | cellular response to peptide | 6.33e-04 |
EGFR | GO:0070663 | regulation of leukocyte proliferation | 6.33e-04 |
EGFR | GO:0043409 | negative regulation of MAPK cascade | 6.33e-04 |
EGFR | GO:0032868 | response to insulin | 6.34e-04 |
EGFR | GO:0006469 | negative regulation of protein kinase activity | 6.64e-04 |
EGFR | GO:0010586 | miRNA metabolic process | 6.75e-04 |
EGFR | GO:0002218 | activation of innate immune response | 6.82e-04 |
EGFR | GO:0018108 | peptidyl-tyrosine phosphorylation | 6.82e-04 |
EGFR | GO:0043407 | negative regulation of MAP kinase activity | 6.85e-04 |
EGFR | GO:0018212 | peptidyl-tyrosine modification | 6.85e-04 |
EGFR | GO:0006979 | response to oxidative stress | 8.17e-04 |
EGFR | GO:0010883 | regulation of lipid storage | 8.17e-04 |
Top |
Related Drugs to ATXN7L1_EGFR |
Drugs used for this fusion-positive patient. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Drug | Source | PMID |
Distribution of the number of studies mentioning ATXN7L1-EGFR and kinase inhibitors the PubMed Abstract (04-01-2024) |
Fusion gene - drug pair 1 | Fusion gene - drug pair 2 | PMID | Publication date | DOI | Study title |
Top |
Related Diseases to ATXN7L1_EGFR |
Diseases that have this fusion gene. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Disease | Source | PMID |
Related diseases from the literature mentioned this fusion gene and drug. (PubMed, 04-01-2024) |
MeSH ID | MeSH term |
Diseases associated with fusion partners. (DisGeNet 4.0) |
Partner | Gene | Disease ID | Disease name | # pubmeds | Source |
Top |
Clinical Trials of the Found Drugs/Small Molecules |
Statistics of the Clinical Trials of the Found Kinase Inibitors from clinicaltrials.gov (06-17-2024) |
Clinical Trials from clinicaltrials.gov (06-17-2024) |
Fusion Gene | Kinase Inhibitor | NCT ID | Study Status | Phases | Disease | # Enrolment | Date |