UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
|
Kinase Fusion Gene:RAB3B_PKN2 |
Kinase Fusion Protein Summary |
Kinase Fusion gene summary |
Kinase Fusion partner gene information | Kinase Fusion gene name: RAB3B_PKN2 | KinaseFusionDB ID: KFG5223 | FusionGDB2.0 ID: KFG5223 | Hgene | Tgene | Gene symbol | RAB3B | PKN2 | Gene ID | 5865 | 5586 | |
Gene name | RAB3B, member RAS oncogene family | protein kinase N2 | ||||||||||
Synonyms | - | PAK2|PRK2|PRKCL2|PRO2042|Pak-2|STK7 | ||||||||||
Cytomap | 1p32.3 | 1p22.2 | ||||||||||
Type of gene | protein-coding | protein-coding | ||||||||||
Description | ras-related protein Rab-3Bbrain antigen RAB3B | serine/threonine-protein kinase N2PKN gammacardiolipin-activated protein kinase Pak2protein kinase C-like 2protein-kinase C-related kinase 2 | ||||||||||
Modification date | 20240411 | 20240323 | ||||||||||
UniProtAcc | P20337 | Q16513 | ||||||||||
Ensembl transtripts involved in fusion gene | ENST ids | ENST00000371655, | ENST00000370505, ENST00000370513, ENST00000495119, ENST00000544045, ENST00000316005, ENST00000370521, | |||||||||
Context (manual curation of fusion genes in KinaseFusionDB) | PubMed: RAB3B [Title/Abstract] AND PKN2 [Title/Abstract] AND fusion [Title/Abstract] | |||||||||||
Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) | RAB3B(52442562)-PKN2(89206671), # samples:2 |
Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
Partner | Gene | GO ID | GO term | PubMed ID |
Hgene | RAB3B | GO:0051586 | positive regulation of dopamine uptake involved in synaptic transmission | 20007772 |
Hgene | RAB3B | GO:0097494 | regulation of vesicle size | 20007772 |
Hgene | RAB3B | GO:0098693 | regulation of synaptic vesicle cycle | 20007772 |
Tgene | PKN2 | GO:0006468 | protein phosphorylation | 17332740 |
Tgene | PKN2 | GO:0010631 | epithelial cell migration | 21754995 |
Kinase Fusion gene breakpoints across RAB3B (5'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Kinase Fusion gene breakpoints across PKN2 (3'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Top |
Kinase Fusion Gene Sample Information |
Kinase Fusion gene information. |
Kinase Fusion gene information from four resources (ChiTars 5.0, ChimerDB 4.0, COSMIC, and CCLE) * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
Source | Sample | Hgene | Hchr | Hbp | Tgene | Tchr | Tbp |
ChimerDB4 | TCGA-DX-A23U-01A | RAB3B | chr1 | 52442562 | PKN2 | chr1 | 89206671 |
Top |
Kinase Fusion ORF Analysis |
Kinase Fusion information from ORFfinder translation from full-length transcript sequence from KinaseFusionDB. |
Henst | Tenst | Hgene | Hchr | Hbp | Tgene | Tchr | Tbp | Seq length (transcript) | Seq length (amino acids) |
ENST00000371655 | ENST00000316005 | RAB3B | chr1 | 52442562 | PKN2 | chr1 | 89206671 | 2666 | 683 |
Top |
Kinase Fusion Amino Acid Sequences |
For individual full-length fusion transcript sequence from KinaseFusionDB, we ran ORFfinder and chose the longest ORF among the all predicted ones. |
>Henst_Tenst_Hgene_Hchr_Hbp_Tgene_Tchr_Tbp_length(fusion AA)_AAseq >ENST00000371655_ENST00000316005_RAB3B_chr1_52442562_PKN2_chr1_89206671_length(amino acids)=683 MPSRRPSGSEPVVPHSESAMASVTDGKTGVKDASDQNFDYMFKLLIIGNSSVGKTSFLFRYADDTFTPAFVSTVGIDFKVKTVYRHEKRV KLQIWGDSRSLPFSENVSAVQKLDFSDTMVQQKLDDIKDRIKREIRKELKIKEGAENLRKVTTDKKSLAYVDNILKKSNKKLEELHHKLQ ELNAHIVVSDPEDITDCPRTPDTPNNDPRCSTSNNRLKALQKQLDIELKVKQGAENMIQMYSNGSSKDRKLHGTAQQLLQDSKTKIEVIR MQILQAVQTNELAFDNAKPVISPLELRMEELRHHFRIEFAVAEGAKNVMKLLGSGKVTDRKALSEAQARFNESSQKLDLLKYSLEQRLNE VPKNHPKSRIIIEELSLVAASPTLSPRQSMISTQNQYSTLSKPAALTGTLEVRLMGCQDILENVPGRSKATSVALPGWSPSETRSSFMSR TSKSKSGSSRNLLKTDDLSNDVCAVLKLDNTVVGQTSWKPISNQSWDQKFTLELDRSRELEISVYWRDWRSLCAVKFLRLEDFLDNQRHG MCLYLEPQGTLFAEVTFFNPVIERRPKLQRQKKIFSKQQGKTFLRAPQMNINIATWGRLVRRAIPTVNHSGTFSPQAPVPTTVPVVDVRI -------------------------------------------------------------- |
Multiple Sequence Alignment of All Fusion Protein Isoforms |
Top |
Kinase Fusion Protein Functional Features |
Four levels of functional features of fusion genes Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr1:52442562/chr1:89206671) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
Main function of each fusion partner protein. (from UniProt) |
Hgene | Tgene |
RAB3B | PKN2 |
FUNCTION: Protein transport. Probably involved in vesicular traffic (By similarity). {ECO:0000250}. | FUNCTION: PKC-related serine/threonine-protein kinase and Rho/Rac effector protein that participates in specific signal transduction responses in the cell. Plays a role in the regulation of cell cycle progression, actin cytoskeleton assembly, cell migration, cell adhesion, tumor cell invasion and transcription activation signaling processes. Phosphorylates CTTN in hyaluronan-induced astrocytes and hence decreases CTTN ability to associate with filamentous actin. Phosphorylates HDAC5, therefore lead to impair HDAC5 import. Direct RhoA target required for the regulation of the maturation of primordial junctions into apical junction formation in bronchial epithelial cells. Required for G2/M phases of the cell cycle progression and abscission during cytokinesis in a ECT2-dependent manner. Stimulates FYN kinase activity that is required for establishment of skin cell-cell adhesion during keratinocytes differentiation. Regulates epithelial bladder cells speed and direction of movement during cell migration and tumor cell invasion. Inhibits Akt pro-survival-induced kinase activity. Mediates Rho protein-induced transcriptional activation via the c-fos serum response factor (SRF). Involved in the negative regulation of ciliogenesis (PubMed:27104747). {ECO:0000269|PubMed:10226025, ECO:0000269|PubMed:10926925, ECO:0000269|PubMed:11777936, ECO:0000269|PubMed:11781095, ECO:0000269|PubMed:15123640, ECO:0000269|PubMed:15364941, ECO:0000269|PubMed:17332740, ECO:0000269|PubMed:20188095, ECO:0000269|PubMed:20974804, ECO:0000269|PubMed:21754995, ECO:0000269|PubMed:27104747, ECO:0000269|PubMed:9121475}.; FUNCTION: (Microbial infection) Phosphorylates HCV NS5B leading to stimulation of HCV RNA replication. {ECO:0000269|PubMed:15364941}. |
Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
- Retained domain in the 5'-partner of fusion protein (protein functional feature from UniProt). |
Partner | Hgeneene | Hbp | Tgeneene | Tbp | ENST | BPexon | TotalExon | Protein feature loci | BPloci | TotalLen | Feature | Note |
- Retained domain in the 3'-partner of fusion protein (protein functional feature from UniProt). |
Partner | Hgeneene | Hbp | Tgeneene | Tbp | ENST | BPexon | TotalExon | Protein feature loci | BPloci | TotalLen | Feature | Note |
Tgene | RAB3B | 52442562 | PKN2 | 89206671 | ENST00000371655 | 0 | 17 | 917_984 | 0 | 659 | Domain | Note=AGC-kinase C-terminal;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00618 |
Tgene | RAB3B | 52442562 | PKN2 | 89206671 | ENST00000371655 | 0 | 21 | 917_984 | 0 | 828 | Domain | Note=AGC-kinase C-terminal;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00618 |
Tgene | RAB3B | 52442562 | PKN2 | 89206671 | ENST00000371655 | 0 | 21 | 917_984 | 16 | 937 | Domain | Note=AGC-kinase C-terminal;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00618 |
Tgene | RAB3B | 52442562 | PKN2 | 89206671 | ENST00000371655 | 0 | 22 | 917_984 | 16 | 985 | Domain | Note=AGC-kinase C-terminal;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00618 |
Tgene | RAB3B | 52442562 | PKN2 | 89206671 | ENST00000371655 | 0 | 17 | 353_473 | 0 | 659 | Domain | Note=C2;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00041 |
Tgene | RAB3B | 52442562 | PKN2 | 89206671 | ENST00000371655 | 0 | 21 | 353_473 | 0 | 828 | Domain | Note=C2;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00041 |
Tgene | RAB3B | 52442562 | PKN2 | 89206671 | ENST00000371655 | 0 | 21 | 353_473 | 16 | 937 | Domain | Note=C2;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00041 |
Tgene | RAB3B | 52442562 | PKN2 | 89206671 | ENST00000371655 | 0 | 22 | 353_473 | 16 | 985 | Domain | Note=C2;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00041 |
Tgene | RAB3B | 52442562 | PKN2 | 89206671 | ENST00000371655 | 0 | 17 | 657_916 | 0 | 659 | Domain | Note=Protein kinase;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00159 |
Tgene | RAB3B | 52442562 | PKN2 | 89206671 | ENST00000371655 | 0 | 21 | 657_916 | 0 | 828 | Domain | Note=Protein kinase;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00159 |
Tgene | RAB3B | 52442562 | PKN2 | 89206671 | ENST00000371655 | 0 | 21 | 657_916 | 16 | 937 | Domain | Note=Protein kinase;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00159 |
Tgene | RAB3B | 52442562 | PKN2 | 89206671 | ENST00000371655 | 0 | 22 | 657_916 | 16 | 985 | Domain | Note=Protein kinase;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00159 |
Tgene | RAB3B | 52442562 | PKN2 | 89206671 | ENST00000371655 | 0 | 17 | 33_109 | 0 | 659 | Domain | Note=REM-1 1;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU01207 |
Tgene | RAB3B | 52442562 | PKN2 | 89206671 | ENST00000371655 | 0 | 21 | 33_109 | 0 | 828 | Domain | Note=REM-1 1;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU01207 |
Tgene | RAB3B | 52442562 | PKN2 | 89206671 | ENST00000371655 | 0 | 21 | 33_109 | 16 | 937 | Domain | Note=REM-1 1;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU01207 |
Tgene | RAB3B | 52442562 | PKN2 | 89206671 | ENST00000371655 | 0 | 22 | 33_109 | 16 | 985 | Domain | Note=REM-1 1;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU01207 |
Tgene | RAB3B | 52442562 | PKN2 | 89206671 | ENST00000371655 | 0 | 17 | 121_203 | 0 | 659 | Domain | Note=REM-1 2;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU01207 |
Tgene | RAB3B | 52442562 | PKN2 | 89206671 | ENST00000371655 | 0 | 21 | 121_203 | 0 | 828 | Domain | Note=REM-1 2;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU01207 |
Tgene | RAB3B | 52442562 | PKN2 | 89206671 | ENST00000371655 | 0 | 21 | 121_203 | 16 | 937 | Domain | Note=REM-1 2;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU01207 |
Tgene | RAB3B | 52442562 | PKN2 | 89206671 | ENST00000371655 | 0 | 22 | 121_203 | 16 | 985 | Domain | Note=REM-1 2;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU01207 |
Tgene | RAB3B | 52442562 | PKN2 | 89206671 | ENST00000371655 | 0 | 17 | 204_284 | 0 | 659 | Domain | Note=REM-1 3;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU01207 |
Tgene | RAB3B | 52442562 | PKN2 | 89206671 | ENST00000371655 | 0 | 21 | 204_284 | 0 | 828 | Domain | Note=REM-1 3;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU01207 |
Tgene | RAB3B | 52442562 | PKN2 | 89206671 | ENST00000371655 | 0 | 21 | 204_284 | 16 | 937 | Domain | Note=REM-1 3;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU01207 |
Tgene | RAB3B | 52442562 | PKN2 | 89206671 | ENST00000371655 | 0 | 22 | 204_284 | 16 | 985 | Domain | Note=REM-1 3;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU01207 |
Top |
Kinase Fusion Protein Structures |
CIF files of the predicted kinase fusion proteins * Here we show the 3D structure of the fusion proteins using Mol*. AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Model confidence is shown from the pLDDT values per residue. pLDDT corresponds to the model’s prediction of its score on the local Distance Difference Test. It is a measure of local accuracy (from AlphfaFold website). To color code individual residues, we transformed individual PDB files into CIF format. |
Kinase Fusion protein CIF link (fusion AA seq ID in KinaseFusionDB) | Henst | Tenst | Hgene | Hchr | Hbp | Tgene | Tchr | Tbp | AA seq | Len(AA seq) |
PDB file >>>402_RAB3B_PKN2 | ENST00000371655 | ENST00000316005 | RAB3B | chr1 | 52442562 | PKN2 | chr1 | 89206671 | MPSRRPSGSEPVVPHSESAMASVTDGKTGVKDASDQNFDYMFKLLIIGNSSVGKTSFLFRYADDTFTPAFVSTVGIDFKVKTVYRHEKRV KLQIWGDSRSLPFSENVSAVQKLDFSDTMVQQKLDDIKDRIKREIRKELKIKEGAENLRKVTTDKKSLAYVDNILKKSNKKLEELHHKLQ ELNAHIVVSDPEDITDCPRTPDTPNNDPRCSTSNNRLKALQKQLDIELKVKQGAENMIQMYSNGSSKDRKLHGTAQQLLQDSKTKIEVIR MQILQAVQTNELAFDNAKPVISPLELRMEELRHHFRIEFAVAEGAKNVMKLLGSGKVTDRKALSEAQARFNESSQKLDLLKYSLEQRLNE VPKNHPKSRIIIEELSLVAASPTLSPRQSMISTQNQYSTLSKPAALTGTLEVRLMGCQDILENVPGRSKATSVALPGWSPSETRSSFMSR TSKSKSGSSRNLLKTDDLSNDVCAVLKLDNTVVGQTSWKPISNQSWDQKFTLELDRSRELEISVYWRDWRSLCAVKFLRLEDFLDNQRHG MCLYLEPQGTLFAEVTFFNPVIERRPKLQRQKKIFSKQQGKTFLRAPQMNINIATWGRLVRRAIPTVNHSGTFSPQAPVPTTVPVVDVRI | 683 |
3D view using mol* of 402_RAB3B_PKN2 | ||||||||||
PDB file >>>TKFP_682_RAB3B_PKN2 | ENST00000371655 | ENST00000316005 | RAB3B | chr1 | 52442562 | PKN2 | chr1 | 89206671 | MPSRRPSGSEPVVPHSESAMASVTDGKTGVKDASDQNFDYMFKLLIIGNSSVGKTSFLFRYADDTFTPAFVSTVGIDFKVKTVYRHEKRV KLQIWGDSRSLPFSENVSAVQKLDFSDTMVQQKLDDIKDRIKREIRKELKIKEGAENLRKVTTDKKSLAYVDNILKKSNKKLEELHHKLQ ELNAHIVVSDPEDITDCPRTPDTPNNDPRCSTSNNRLKALQKQLDIELKVKQGAENMIQMYSNGSSKDRKLHGTAQQLLQDSKTKIEVIR MQILQAVQTNELAFDNAKPVISPLELRMEELRHHFRIEFAVAEGAKNVMKLLGSGKVTDRKALSEAQARFNESSQKLDLLKYSLEQRLNE VPKNHPKSRIIIEELSLVAASPTLSPRQSMISTQNQYSTLSKPAALTGTLEVRLMGCQDILENVPGRSKATSVALPGWSPSETRSSFMSR TSKSKSGSSRNLLKTDDLSNDVCAVLKLDNTVVGQTSWKPISNQSWDQKFTLELDRSRELEISVYWRDWRSLCAVKFLRLEDFLDNQRHG MCLYLEPQGTLFAEVTFFNPVIERRPKLQRQKKIFSKQQGKTFLRAPQMNINIATWGRLVRRAIPTVNHSGTFSPQAPVPTTVPVVDVRI | 683_RAB3B_PKN2 |
Top |
Comparison of Fusion Protein Isoforms |
Superimpose the 3D Structures Among All Fusion Protein Isoforms * Download the pdb file and open it from the molstar online viewer. |
Comparison of the Secondary Structures of Fusion Protein Isoforms |
Top |
Comparison of Fusion Protein Sequences/Structures with Known Sequences/Structures from PDB |
Top |
pLDDT score distribution |
pLDDT score distribution of the predicted fusion protein structures from AlphaFold2 * AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. * The blue color at the bottom marks the best active site residues. |
402_RAB3B_PKN2.png |
402_RAB3B_PKN2.png |
Top |
Potential Active Site Information |
The potential binding sites of these fusion proteins were identified using SiteMap, a module of the Schrodinger suite. |
Kinase Fusion AA seq ID in KinaseFusionDB | Site score | Size | Dscore | Volume | Exposure | Enclosure | Contact | Phobic | Philic | Balance | Don/Acc | Residues |
Top |
Ramachandran Plot of Kinase Fusion Protein Structure |
Ramachandran plot of the torsional angles - phi (φ)and psi (ψ) - of the residues (amino acids) contained in this fusion protein peptide. |
402_RAB3B_PKN2_ramachandran.png |
Top |
Virtual Screening Results |
Distribution of the average docking score across all approved kinase inhibitors. Distribution of the number of occurrence across all approved kinase inhibitors. |
5'-kinase fusion protein case |
3'-kinase fusion protein case |
Top |
Drug information from DrugBank of the top 20 interacting small molecules. * The detailed information of individual kinase inhibitors are available in the download page. |
Fusion gene name info | Drug | Docking score | Glide g score | Glide energy |
Top |
Kinase-Substrate Information of RAB3B_PKN2 |
Phosphorylation target of the kinase (phosphosite, 03-17-2024) |
Kinase | Kinase UniProt Acc | Kinase species | Substrate | Substrate UniProt Acc | Substrate phosphorylated residues | Substrate phosphorylated sites (+/-7AA) | Domain |
PKN2 | Q16513 | human | NOS3 | P29474 | S1179 | RIRtQsFsLQERQLR | |
PKN2 | Q16513 | human | MEFV | O15553 | S208 | VRLRRNAssAGRLQG | |
PKN2 | Q16513 | human | MEFV | O15553 | S242 | SGKMRPRsLEVTIST |
Biological Network Integration of This Kinase and Substrates (GeneMANIA website) |
Enriched GO biological processes of the phosphorylation target genes of the kinase |
Kinase | GOID | GO term | P.adjust |
PKN2 | ID | Description | 0.00e+00 |
PKN2 | GO:0032102 | negative regulation of response to external stimulus | 2.18e-02 |
PKN2 | GO:0014745 | negative regulation of muscle adaptation | 2.18e-02 |
PKN2 | GO:0006527 | arginine catabolic process | 2.18e-02 |
PKN2 | GO:1900226 | negative regulation of NLRP3 inflammasome complex assembly | 2.18e-02 |
PKN2 | GO:0030728 | ovulation | 2.18e-02 |
PKN2 | GO:0141086 | negative regulation of inflammasome-mediated signaling pathway | 2.18e-02 |
PKN2 | GO:0030810 | positive regulation of nucleotide biosynthetic process | 2.18e-02 |
PKN2 | GO:1900373 | positive regulation of purine nucleotide biosynthetic process | 2.18e-02 |
PKN2 | GO:0010544 | negative regulation of platelet activation | 2.18e-02 |
PKN2 | GO:0003184 | pulmonary valve morphogenesis | 2.18e-02 |
PKN2 | GO:0032695 | negative regulation of interleukin-12 production | 2.18e-02 |
PKN2 | GO:0006525 | arginine metabolic process | 2.18e-02 |
PKN2 | GO:0045981 | positive regulation of nucleotide metabolic process | 2.18e-02 |
PKN2 | GO:1900544 | positive regulation of purine nucleotide metabolic process | 2.18e-02 |
PKN2 | GO:0003177 | pulmonary valve development | 2.18e-02 |
PKN2 | GO:0019430 | removal of superoxide radicals | 2.18e-02 |
PKN2 | GO:0071450 | cellular response to oxygen radical | 2.18e-02 |
PKN2 | GO:0071451 | cellular response to superoxide | 2.18e-02 |
PKN2 | GO:0002026 | regulation of the force of heart contraction | 2.18e-02 |
PKN2 | GO:0009065 | glutamine family amino acid catabolic process | 2.18e-02 |
PKN2 | GO:0000303 | response to superoxide | 2.18e-02 |
PKN2 | GO:0000305 | response to oxygen radical | 2.18e-02 |
PKN2 | GO:0007263 | nitric oxide mediated signal transduction | 2.18e-02 |
PKN2 | GO:0070168 | negative regulation of biomineral tissue development | 2.18e-02 |
PKN2 | GO:0032682 | negative regulation of chemokine production | 2.18e-02 |
PKN2 | GO:1902042 | negative regulation of extrinsic apoptotic signaling pathway via death domain receptors | 2.18e-02 |
PKN2 | GO:0030808 | regulation of nucleotide biosynthetic process | 2.18e-02 |
PKN2 | GO:1900371 | regulation of purine nucleotide biosynthetic process | 2.18e-02 |
PKN2 | GO:0034405 | response to fluid shear stress | 2.18e-02 |
PKN2 | GO:1900225 | regulation of NLRP3 inflammasome complex assembly | 2.18e-02 |
PKN2 | GO:0048873 | homeostasis of number of cells within a tissue | 2.18e-02 |
PKN2 | GO:0039532 | negative regulation of viral-induced cytoplasmic pattern recognition receptor signaling pathway | 2.18e-02 |
PKN2 | GO:0043267 | negative regulation of potassium ion transport | 2.18e-02 |
PKN2 | GO:0044546 | NLRP3 inflammasome complex assembly | 2.18e-02 |
PKN2 | GO:0070269 | pyroptosis | 2.18e-02 |
PKN2 | GO:0141085 | regulation of inflammasome-mediated signaling pathway | 2.18e-02 |
PKN2 | GO:0001990 | regulation of systemic arterial blood pressure by hormone | 2.18e-02 |
PKN2 | GO:0003180 | aortic valve morphogenesis | 2.18e-02 |
PKN2 | GO:0031281 | positive regulation of cyclase activity | 2.18e-02 |
PKN2 | GO:0140632 | canonical inflammasome complex assembly | 2.18e-02 |
PKN2 | GO:0051349 | positive regulation of lyase activity | 2.18e-02 |
PKN2 | GO:0003203 | endocardial cushion morphogenesis | 2.18e-02 |
PKN2 | GO:0045454 | cell redox homeostasis | 2.18e-02 |
PKN2 | GO:1900016 | negative regulation of cytokine production involved in inflammatory response | 2.18e-02 |
PKN2 | GO:0141084 | inflammasome-mediated signaling pathway | 2.18e-02 |
PKN2 | GO:0003176 | aortic valve development | 2.18e-02 |
PKN2 | GO:0060412 | ventricular septum morphogenesis | 2.18e-02 |
PKN2 | GO:0032691 | negative regulation of interleukin-1 beta production | 2.18e-02 |
PKN2 | GO:0003044 | regulation of systemic arterial blood pressure mediated by a chemical signal | 2.18e-02 |
Top |
Related Drugs to RAB3B_PKN2 |
Drugs used for this fusion-positive patient. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Drug | Source | PMID |
Distribution of the number of studies mentioning RAB3B-PKN2 and kinase inhibitors the PubMed Abstract (04-01-2024) |
Fusion gene - drug pair 1 | Fusion gene - drug pair 2 | PMID | Publication date | DOI | Study title |
Top |
Related Diseases to RAB3B_PKN2 |
Diseases that have this fusion gene. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Disease | Source | PMID |
Related diseases from the literature mentioned this fusion gene and drug. (PubMed, 04-01-2024) |
MeSH ID | MeSH term |
Diseases associated with fusion partners. (DisGeNet 4.0) |
Partner | Gene | Disease ID | Disease name | # pubmeds | Source |
Top |
Clinical Trials of the Found Drugs/Small Molecules |
Statistics of the Clinical Trials of the Found Kinase Inibitors from clinicaltrials.gov (06-17-2024) |
Clinical Trials from clinicaltrials.gov (06-17-2024) |
Fusion Gene | Kinase Inhibitor | NCT ID | Study Status | Phases | Disease | # Enrolment | Date |