UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
|
Kinase Fusion Gene:RNF149_MAP4K4 |
Kinase Fusion Protein Summary |
Kinase Fusion gene summary |
Kinase Fusion partner gene information | Kinase Fusion gene name: RNF149_MAP4K4 | KinaseFusionDB ID: KFG5405 | FusionGDB2.0 ID: KFG5405 | Hgene | Tgene | Gene symbol | RNF149 | MAP4K4 | Gene ID | 284996 | 9448 | |
Gene name | ring finger protein 149 | mitogen-activated protein kinase kinase kinase kinase 4 | ||||||||||
Synonyms | DNAPTP2 | FLH21957|HEL-S-31|HGK|MEKKK4|NIK | ||||||||||
Cytomap | 2q11.2 | 2q11.2 | ||||||||||
Type of gene | protein-coding | protein-coding | ||||||||||
Description | E3 ubiquitin-protein ligase RNF149DNA polymerase-transactivated protein 2RING-type E3 ubiquitin transferase RNF149 | mitogen-activated protein kinase kinase kinase kinase 4HPK/GCK-like kinase HGKMAPK/ERK kinase kinase kinase 4MEK kinase kinase 4Ste20 group protein kinase HGKepididymis secretory protein Li 31hepatocyte progenitor kinase-like/germinal center kinase- | ||||||||||
Modification date | 20240403 | 20240407 | ||||||||||
UniProtAcc | Q8NC42 | O95819 | ||||||||||
Ensembl transtripts involved in fusion gene | ENST ids | ENST00000295317, ENST00000485752, | ENST00000350878, ENST00000498066, ENST00000302217, ENST00000324219, ENST00000347699, ENST00000350198, ENST00000413150, ENST00000425019, ENST00000456652, | |||||||||
Context (manual curation of fusion genes in KinaseFusionDB) | PubMed: RNF149 [Title/Abstract] AND MAP4K4 [Title/Abstract] AND fusion [Title/Abstract] | |||||||||||
Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) | RNF149(101910476)-MAP4K4(102407182), # samples:2 |
Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
Partner | Gene | GO ID | GO term | PubMed ID |
Tgene | MAP4K4 | GO:0006468 | protein phosphorylation | 9890973 |
Tgene | MAP4K4 | GO:0035556 | intracellular signal transduction | 9890973 |
Tgene | MAP4K4 | GO:0046328 | regulation of JNK cascade | 14966141 |
Kinase Fusion gene breakpoints across RNF149 (5'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Kinase Fusion gene breakpoints across MAP4K4 (3'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Top |
Kinase Fusion Gene Sample Information |
Kinase Fusion gene information. |
Kinase Fusion gene information from four resources (ChiTars 5.0, ChimerDB 4.0, COSMIC, and CCLE) * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
Source | Sample | Hgene | Hchr | Hbp | Tgene | Tchr | Tbp |
ChimerDB4 | TCGA-24-1553-01A | RNF149 | chr2 | 101910476 | MAP4K4 | chr2 | 102407182 |
Top |
Kinase Fusion ORF Analysis |
Kinase Fusion information from ORFfinder translation from full-length transcript sequence from KinaseFusionDB. |
Henst | Tenst | Hgene | Hchr | Hbp | Tgene | Tchr | Tbp | Seq length (transcript) | Seq length (amino acids) |
ENST00000295317 | ENST00000425019 | RNF149 | chr2 | 101910476 | MAP4K4 | chr2 | 102407182 | 4831 | 1502 |
Top |
Kinase Fusion Amino Acid Sequences |
For individual full-length fusion transcript sequence from KinaseFusionDB, we ran ORFfinder and chose the longest ORF among the all predicted ones. |
>Henst_Tenst_Hgene_Hchr_Hbp_Tgene_Tchr_Tbp_length(fusion AA)_AAseq >ENST00000295317_ENST00000425019_RNF149_chr2_101910476_MAP4K4_chr2_102407182_length(amino acids)=1502 MTPPSQLSGAAMAWRRREASVGARGVLALALLALALCVPGARGRALEWFSAVVNIEYVDPQTNLTVWSVSESGRFGDSSPKEGAHGLVGV PWAPGGDLEGCAPDTRFFVPEPGGRGAAPWVALVARGGCTFKDKVLVAARRNASAVVLYNEERYGNITLPMSHAGTGNIVVIMISYPKGR EILELVQKGIPVTMTIGVGTRHVQEFISGQSVVFVAIAFITMMIISLAWLIFYYIQRFLYTGSQIGSQSHRKETKKVIGQLLLHTVKHGE KGRHVKTGQLAAIKVMDVTEDEEEEIKLEINMLKKYSHHRNIATYYGAFIKKSPPGHDDQLWLVMEFCGAGSITDLVKNTKGNTLKEDWI AYISREILRGLAHLHIHHVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDRTVGRRNTFIGTPYWMAPEVIACDENPDATYDYRSDLWSCG ITAIEMAEGAPPLCDMHPMRALFLIPRNPPPRLKSKKWSKKFFSFIEGCLVKNYMQRPSTEQLLKHPFIRDQPNERQVRIQLKDHIDRTR KKRGEKDETEYEYSGSEEEEEEVPEQEGEPSSIVNVPGESTLRRDFLRLQQENKERSEALRRQQLLQEQQLREQEEYKRQLLAERQKRIE QQKEQRRRLEEQQRREREARRQQEREQRRREQEEKRRLEELERRRKEEEERRRAEEEKRRVEREQEYIRRQLEEEQRHLEVLQQQLLQEQ AMLLHDHRRPHPQHSQQPPPPQQERSKPSFHAPEPKAHYEPADRAREVEDRFRKTNHSSPEAQSKQTGRVLEPPVPSRSESFSNGNSESV HPALQRPAEPQVPVRTTSRSPVLSRRDSPLQGSGQQNSQAGQRNSTSIEPRLLWERVEKLVPRPGSGSSSGSSNSGSQPGSHPGSQSGSG ERFRVRSSSKSEGSPSQRLENAVKKPEDKKEVFRPLKPADLTALAKELRAVEDVRPPHKVTDYSSSSEESGTTDEEDDDVEQEGADESTS GPEDTRAASSLNLSNGETESVKTMIVHDDVESEPAMTPSKEGTLIVRQSTVDQKRASHHESNGFAGRIHLLPDLLQQSHSSSTSSTSSSP SSSQPTPTMSPQTPQDKLTANETQSASSTLQKHKSSSSFTPFIDPRLLQISPSSGTTVTSVVGFSCDGMRPEAIRQDPTRKGSVVNVNPT NTRPQSDTPEIRKYKKRFNSEILCAALWGVNLLVGTESGLMLLDRSGQGKVYPLINRRRFQQMDVLEGLNVLVTISGKKDKLRVYYLSWL RNKILHNDPEVEKKQGWTTVGDLEGCVHYKVVKYERIKFLVIALKSSVEVYAWAPKPYHKFMAFKSFGELVHKPLLVDLTVEEGQRLKVI YGSCAGFHAVDVDSGSVYDIYLPTHIQCSIKPHAIIILPNTDGMELLVCYEDEGVYVNTYGRITKDVVLQWGEMPTSVAYIRSNQTMGWG -------------------------------------------------------------- |
Multiple Sequence Alignment of All Fusion Protein Isoforms |
Top |
Kinase Fusion Protein Functional Features |
Four levels of functional features of fusion genes Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr2:101910476/chr2:102407182) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
Main function of each fusion partner protein. (from UniProt) |
Hgene | Tgene |
RNF149 | MAP4K4 |
FUNCTION: E3 ubiquitin-protein ligase. Ubiquitinates BRAF, inducing its proteasomal degradation. {ECO:0000269|PubMed:22628551}. | FUNCTION: Serine/threonine kinase that may play a role in the response to environmental stress and cytokines such as TNF-alpha. Appears to act upstream of the JUN N-terminal pathway. Phosphorylates SMAD1 on Thr-322. {ECO:0000269|PubMed:21690388, ECO:0000269|PubMed:9890973}. |
Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
- Retained domain in the 5'-partner of fusion protein (protein functional feature from UniProt). |
Partner | Hgeneene | Hbp | Tgeneene | Tbp | ENST | BPexon | TotalExon | Protein feature loci | BPloci | TotalLen | Feature | Note |
- Retained domain in the 3'-partner of fusion protein (protein functional feature from UniProt). |
Partner | Hgeneene | Hbp | Tgeneene | Tbp | ENST | BPexon | TotalExon | Protein feature loci | BPloci | TotalLen | Feature | Note |
Tgene | RNF149 | 101910476 | MAP4K4 | 102407182 | ENST00000295317 | 1 | 30 | 926_1213 | 41 | 1240 | Domain | Note=CNH;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00795 |
Top |
Kinase Fusion Protein Structures |
CIF files of the predicted kinase fusion proteins * Here we show the 3D structure of the fusion proteins using Mol*. AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Model confidence is shown from the pLDDT values per residue. pLDDT corresponds to the model’s prediction of its score on the local Distance Difference Test. It is a measure of local accuracy (from AlphfaFold website). To color code individual residues, we transformed individual PDB files into CIF format. |
Kinase Fusion protein CIF link (fusion AA seq ID in KinaseFusionDB) | Henst | Tenst | Hgene | Hchr | Hbp | Tgene | Tchr | Tbp | AA seq | Len(AA seq) |
PDB file >>>422_RNF149_MAP4K4 | ENST00000295317 | ENST00000425019 | RNF149 | chr2 | 101910476 | MAP4K4 | chr2 | 102407182 | MTPPSQLSGAAMAWRRREASVGARGVLALALLALALCVPGARGRALEWFSAVVNIEYVDPQTNLTVWSVSESGRFGDSSPKEGAHGLVGV PWAPGGDLEGCAPDTRFFVPEPGGRGAAPWVALVARGGCTFKDKVLVAARRNASAVVLYNEERYGNITLPMSHAGTGNIVVIMISYPKGR EILELVQKGIPVTMTIGVGTRHVQEFISGQSVVFVAIAFITMMIISLAWLIFYYIQRFLYTGSQIGSQSHRKETKKVIGQLLLHTVKHGE KGRHVKTGQLAAIKVMDVTEDEEEEIKLEINMLKKYSHHRNIATYYGAFIKKSPPGHDDQLWLVMEFCGAGSITDLVKNTKGNTLKEDWI AYISREILRGLAHLHIHHVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDRTVGRRNTFIGTPYWMAPEVIACDENPDATYDYRSDLWSCG ITAIEMAEGAPPLCDMHPMRALFLIPRNPPPRLKSKKWSKKFFSFIEGCLVKNYMQRPSTEQLLKHPFIRDQPNERQVRIQLKDHIDRTR KKRGEKDETEYEYSGSEEEEEEVPEQEGEPSSIVNVPGESTLRRDFLRLQQENKERSEALRRQQLLQEQQLREQEEYKRQLLAERQKRIE QQKEQRRRLEEQQRREREARRQQEREQRRREQEEKRRLEELERRRKEEEERRRAEEEKRRVEREQEYIRRQLEEEQRHLEVLQQQLLQEQ AMLLHDHRRPHPQHSQQPPPPQQERSKPSFHAPEPKAHYEPADRAREVEDRFRKTNHSSPEAQSKQTGRVLEPPVPSRSESFSNGNSESV HPALQRPAEPQVPVRTTSRSPVLSRRDSPLQGSGQQNSQAGQRNSTSIEPRLLWERVEKLVPRPGSGSSSGSSNSGSQPGSHPGSQSGSG ERFRVRSSSKSEGSPSQRLENAVKKPEDKKEVFRPLKPADLTALAKELRAVEDVRPPHKVTDYSSSSEESGTTDEEDDDVEQEGADESTS GPEDTRAASSLNLSNGETESVKTMIVHDDVESEPAMTPSKEGTLIVRQSTVDQKRASHHESNGFAGRIHLLPDLLQQSHSSSTSSTSSSP SSSQPTPTMSPQTPQDKLTANETQSASSTLQKHKSSSSFTPFIDPRLLQISPSSGTTVTSVVGFSCDGMRPEAIRQDPTRKGSVVNVNPT NTRPQSDTPEIRKYKKRFNSEILCAALWGVNLLVGTESGLMLLDRSGQGKVYPLINRRRFQQMDVLEGLNVLVTISGKKDKLRVYYLSWL RNKILHNDPEVEKKQGWTTVGDLEGCVHYKVVKYERIKFLVIALKSSVEVYAWAPKPYHKFMAFKSFGELVHKPLLVDLTVEEGQRLKVI YGSCAGFHAVDVDSGSVYDIYLPTHIQCSIKPHAIIILPNTDGMELLVCYEDEGVYVNTYGRITKDVVLQWGEMPTSVAYIRSNQTMGWG | 1502 |
3D view using mol* of 422_RNF149_MAP4K4 | ||||||||||
PDB file >>>TKFP_707_RNF149_MAP4K4 | ENST00000295317 | ENST00000425019 | RNF149 | chr2 | 101910476 | MAP4K4 | chr2 | 102407182 | MTPPSQLSGAAMAWRRREASVGARGVLALALLALALCVPGARGRALEWFSAVVNIEYVDPQTNLTVWSVSESGRFGDSSPKEGAHGLVGV PWAPGGDLEGCAPDTRFFVPEPGGRGAAPWVALVARGGCTFKDKVLVAARRNASAVVLYNEERYGNITLPMSHAGTGNIVVIMISYPKGR EILELVQKGIPVTMTIGVGTRHVQEFISGQSVVFVAIAFITMMIISLAWLIFYYIQRFLYTGSQIGSQSHRKETKKVIGQLLLHTVKHGE KGRHVKTGQLAAIKVMDVTEDEEEEIKLEINMLKKYSHHRNIATYYGAFIKKSPPGHDDQLWLVMEFCGAGSITDLVKNTKGNTLKEDWI AYISREILRGLAHLHIHHVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDRTVGRRNTFIGTPYWMAPEVIACDENPDATYDYRSDLWSCG ITAIEMAEGAPPLCDMHPMRALFLIPRNPPPRLKSKKWSKKFFSFIEGCLVKNYMQRPSTEQLLKHPFIRDQPNERQVRIQLKDHIDRTR KKRGEKDETEYEYSGSEEEEEEVPEQEGEPSSIVNVPGESTLRRDFLRLQQENKERSEALRRQQLLQEQQLREQEEYKRQLLAERQKRIE QQKEQRRRLEEQQRREREARRQQEREQRRREQEEKRRLEELERRRKEEEERRRAEEEKRRVEREQEYIRRQLEEEQRHLEVLQQQLLQEQ AMLLHDHRRPHPQHSQQPPPPQQERSKPSFHAPEPKAHYEPADRAREVEDRFRKTNHSSPEAQSKQTGRVLEPPVPSRSESFSNGNSESV HPALQRPAEPQVPVRTTSRSPVLSRRDSPLQGSGQQNSQAGQRNSTSIEPRLLWERVEKLVPRPGSGSSSGSSNSGSQPGSHPGSQSGSG ERFRVRSSSKSEGSPSQRLENAVKKPEDKKEVFRPLKPADLTALAKELRAVEDVRPPHKVTDYSSSSEESGTTDEEDDDVEQEGADESTS GPEDTRAASSLNLSNGETESVKTMIVHDDVESEPAMTPSKEGTLIVRQSTVDQKRASHHESNGFAGRIHLLPDLLQQSHSSSTSSTSSSP SSSQPTPTMSPQTPQDKLTANETQSASSTLQKHKSSSSFTPFIDPRLLQISPSSGTTVTSVVGFSCDGMRPEAIRQDPTRKGSVVNVNPT NTRPQSDTPEIRKYKKRFNSEILCAALWGVNLLVGTESGLMLLDRSGQGKVYPLINRRRFQQMDVLEGLNVLVTISGKKDKLRVYYLSWL RNKILHNDPEVEKKQGWTTVGDLEGCVHYKVVKYERIKFLVIALKSSVEVYAWAPKPYHKFMAFKSFGELVHKPLLVDLTVEEGQRLKVI YGSCAGFHAVDVDSGSVYDIYLPTHIQCSIKPHAIIILPNTDGMELLVCYEDEGVYVNTYGRITKDVVLQWGEMPTSVAYIRSNQTMGWG | 1502_RNF149_MAP4K4 |
Top |
Comparison of Fusion Protein Isoforms |
Superimpose the 3D Structures Among All Fusion Protein Isoforms * Download the pdb file and open it from the molstar online viewer. |
Comparison of the Secondary Structures of Fusion Protein Isoforms |
Top |
Comparison of Fusion Protein Sequences/Structures with Known Sequences/Structures from PDB |
Top |
pLDDT score distribution |
pLDDT score distribution of the predicted fusion protein structures from AlphaFold2 * AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. * The blue color at the bottom marks the best active site residues. |
422_RNF149_MAP4K4.png |
422_RNF149_MAP4K4.png |
Top |
Potential Active Site Information |
The potential binding sites of these fusion proteins were identified using SiteMap, a module of the Schrodinger suite. |
Kinase Fusion AA seq ID in KinaseFusionDB | Site score | Size | Dscore | Volume | Exposure | Enclosure | Contact | Phobic | Philic | Balance | Don/Acc | Residues |
Top |
Ramachandran Plot of Kinase Fusion Protein Structure |
Ramachandran plot of the torsional angles - phi (φ)and psi (ψ) - of the residues (amino acids) contained in this fusion protein peptide. |
422_RNF149_MAP4K4_ramachandran.png |
Top |
Virtual Screening Results |
Distribution of the average docking score across all approved kinase inhibitors. Distribution of the number of occurrence across all approved kinase inhibitors. |
5'-kinase fusion protein case |
3'-kinase fusion protein case |
Top |
Drug information from DrugBank of the top 20 interacting small molecules. * The detailed information of individual kinase inhibitors are available in the download page. |
Fusion gene name info | Drug | Docking score | Glide g score | Glide energy |
Top |
Kinase-Substrate Information of RNF149_MAP4K4 |
Phosphorylation target of the kinase (phosphosite, 03-17-2024) |
Kinase | Kinase UniProt Acc | Kinase species | Substrate | Substrate UniProt Acc | Substrate phosphorylated residues | Substrate phosphorylated sites (+/-7AA) | Domain |
MAP4K4 | O95819 | human | RDX | P35241 | T564 | AGRDKyKtLRQIRQG | ERM_C |
MAP4K4 | O95819 | human | EZR | P15311 | T567 | QGRDkyKtLRQIRQG | ERM_C |
MAP4K4 | O95819 | human | SMAD1 | Q15797 | T322 | sNVNRNStIENTRRH | MH2 |
MAP4K4 | O95819 | human | NR3C1 | P04150 | T562 | StWRIMTtLNMLGGR | Hormone_recep |
MAP4K4 | O95819 | human | LATS1 | O95835 | T1079 | EHAFyEFtFRRFFDD | |
MAP4K4 | O95819 | human | HTT | P42858 | S13 | kLMkAFEsLksFQQQ | |
MAP4K4 | O95819 | human | MAP3K11 | Q16584 | T738 | EEEPRGGtVsPPPGT | |
MAP4K4 | O95819 | human | ADAM10 | O14672 | S436 | NNKFSLCsIRNISQV | Reprolysin_2 |
MAP4K4 | O95819 | human | NR3C1 | P04150 | T519 | SENPGNKtIVPAtLP | |
MAP4K4 | O95819 | human | MSN | P26038 | T558 | LGRDKyKtLRQIRQG | ERM_C |
MAP4K4 | O95819 | human | HTT | P42858 | T3 | _____MAtLEkLMkA |
Biological Network Integration of This Kinase and Substrates (GeneMANIA website) |
Enriched GO biological processes of the phosphorylation target genes of the kinase |
Kinase | GOID | GO term | P.adjust |
MAP4K4 | ID | Description | 0.00e+00 |
MAP4K4 | GO:1902946 | protein localization to early endosome | 4.12e-06 |
MAP4K4 | GO:1905668 | positive regulation of protein localization to endosome | 4.12e-06 |
MAP4K4 | GO:1905666 | regulation of protein localization to endosome | 4.12e-06 |
MAP4K4 | GO:1903651 | positive regulation of cytoplasmic transport | 4.91e-06 |
MAP4K4 | GO:2000641 | regulation of early endosome to late endosome transport | 8.36e-06 |
MAP4K4 | GO:0036010 | protein localization to endosome | 2.10e-05 |
MAP4K4 | GO:1903649 | regulation of cytoplasmic transport | 3.05e-05 |
MAP4K4 | GO:0045022 | early endosome to late endosome transport | 7.10e-05 |
MAP4K4 | GO:0061028 | establishment of endothelial barrier | 7.89e-05 |
MAP4K4 | GO:0098927 | vesicle-mediated transport between endosomal compartments | 7.89e-05 |
MAP4K4 | GO:1902115 | regulation of organelle assembly | 1.09e-04 |
MAP4K4 | GO:0001885 | endothelial cell development | 1.48e-04 |
MAP4K4 | GO:0032535 | regulation of cellular component size | 7.52e-04 |
MAP4K4 | GO:0045446 | endothelial cell differentiation | 9.32e-04 |
MAP4K4 | GO:0008360 | regulation of cell shape | 1.25e-03 |
MAP4K4 | GO:0003158 | endothelium development | 1.25e-03 |
MAP4K4 | GO:0016482 | cytosolic transport | 2.41e-03 |
MAP4K4 | GO:0032388 | positive regulation of intracellular transport | 3.06e-03 |
MAP4K4 | GO:0045732 | positive regulation of protein catabolic process | 3.30e-03 |
MAP4K4 | GO:0002064 | epithelial cell development | 3.31e-03 |
MAP4K4 | GO:0010737 | protein kinase A signaling | 3.87e-03 |
MAP4K4 | GO:0022604 | regulation of cell morphogenesis | 4.60e-03 |
MAP4K4 | GO:0044843 | cell cycle G1/S phase transition | 6.06e-03 |
MAP4K4 | GO:1902895 | positive regulation of miRNA transcription | 6.06e-03 |
MAP4K4 | GO:0071900 | regulation of protein serine/threonine kinase activity | 6.06e-03 |
MAP4K4 | GO:0071560 | cellular response to transforming growth factor beta stimulus | 6.06e-03 |
MAP4K4 | GO:0071559 | response to transforming growth factor beta | 6.21e-03 |
MAP4K4 | GO:0043525 | positive regulation of neuron apoptotic process | 6.33e-03 |
MAP4K4 | GO:0034332 | adherens junction organization | 6.33e-03 |
MAP4K4 | GO:2000630 | positive regulation of miRNA metabolic process | 7.72e-03 |
MAP4K4 | GO:0061180 | mammary gland epithelium development | 7.83e-03 |
MAP4K4 | GO:0032386 | regulation of intracellular transport | 7.83e-03 |
MAP4K4 | GO:2000401 | regulation of lymphocyte migration | 8.04e-03 |
MAP4K4 | GO:1902893 | regulation of miRNA transcription | 8.04e-03 |
MAP4K4 | GO:0061614 | miRNA transcription | 8.04e-03 |
MAP4K4 | GO:1990778 | protein localization to cell periphery | 8.04e-03 |
MAP4K4 | GO:0072678 | T cell migration | 8.14e-03 |
MAP4K4 | GO:0042176 | regulation of protein catabolic process | 8.33e-03 |
MAP4K4 | GO:1902117 | positive regulation of organelle assembly | 9.98e-03 |
MAP4K4 | GO:2000628 | regulation of miRNA metabolic process | 1.04e-02 |
MAP4K4 | GO:0043254 | regulation of protein-containing complex assembly | 1.11e-02 |
MAP4K4 | GO:0022406 | membrane docking | 1.11e-02 |
MAP4K4 | GO:0140747 | regulation of ncRNA transcription | 1.11e-02 |
MAP4K4 | GO:0048732 | gland development | 1.27e-02 |
MAP4K4 | GO:1901655 | cellular response to ketone | 1.33e-02 |
MAP4K4 | GO:0010586 | miRNA metabolic process | 1.35e-02 |
MAP4K4 | GO:0007015 | actin filament organization | 1.36e-02 |
MAP4K4 | GO:1903829 | positive regulation of protein localization | 1.44e-02 |
MAP4K4 | GO:0022411 | cellular component disassembly | 1.60e-02 |
Top |
Related Drugs to RNF149_MAP4K4 |
Drugs used for this fusion-positive patient. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Drug | Source | PMID |
Distribution of the number of studies mentioning RNF149-MAP4K4 and kinase inhibitors the PubMed Abstract (04-01-2024) |
Fusion gene - drug pair 1 | Fusion gene - drug pair 2 | PMID | Publication date | DOI | Study title |
Top |
Related Diseases to RNF149_MAP4K4 |
Diseases that have this fusion gene. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Disease | Source | PMID |
Related diseases from the literature mentioned this fusion gene and drug. (PubMed, 04-01-2024) |
MeSH ID | MeSH term |
Diseases associated with fusion partners. (DisGeNet 4.0) |
Partner | Gene | Disease ID | Disease name | # pubmeds | Source |
Top |
Clinical Trials of the Found Drugs/Small Molecules |
Statistics of the Clinical Trials of the Found Kinase Inibitors from clinicaltrials.gov (06-17-2024) |
Clinical Trials from clinicaltrials.gov (06-17-2024) |
Fusion Gene | Kinase Inhibitor | NCT ID | Study Status | Phases | Disease | # Enrolment | Date |