| UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
|
|||||||
|
Kinase Fusion Gene:RPL7A_NTRK1 |
Kinase Fusion Protein Summary |
 Kinase Fusion gene summary |
| Kinase Fusion partner gene information | Kinase Fusion gene name: RPL7A_NTRK1 | KinaseFusionDB ID: KFG5519 | FusionGDB2.0 ID: KFG5519 | Hgene | Tgene | Gene symbol | RPL7A | NTRK1 | Gene ID | 6130 | 4914 | |
| Gene name | ribosomal protein L7a | neurotrophic receptor tyrosine kinase 1 | ||||||||||
| Synonyms | L7A|SURF3|TRUP|eL8 | MTC|TRK|TRK1|TRKA|Trk-A|p140-TrkA | ||||||||||
| Cytomap | 9q34.2 | 1q23.1 | ||||||||||
| Type of gene | protein-coding | protein-coding | ||||||||||
| Description | large ribosomal subunit protein eL860S ribosomal protein L7aPLA-X polypeptidesurfeit 3surfeit locus protein 3thyroid hormone receptor uncoupling protein | high affinity nerve growth factor receptorOncogene TRKTRK1-transforming tyrosine kinase proteingp140trkneurotrophic tyrosine kinase, receptor, type 1tropomyosin receptor kinase Atropomyosin-related kinase Atyrosine kinase receptor A | ||||||||||
| Modification date | 20240407 | 20240411 | ||||||||||
| UniProtAcc | P62424 | P04629 | ||||||||||
| Ensembl transtripts involved in fusion gene | ENST ids | ENST00000463740, ENST00000323345, ENST00000315731, | ENST00000358660, ENST00000368196, ENST00000392302, ENST00000524377, ENST00000531606, | |||||||||
| Context (manual curation of fusion genes in KinaseFusionDB) | PubMed: RPL7A [Title/Abstract] AND NTRK1 [Title/Abstract] AND fusion [Title/Abstract] | |||||||||||
| Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) | RPL7A(136215897)-NTRK1(156844362), # samples:1 | |||||||||||
| Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Partner | Gene | GO ID | GO term | PubMed ID |
| Tgene | NTRK1 | GO:0006468 | protein phosphorylation | 15488758 |
| Tgene | NTRK1 | GO:0008285 | negative regulation of cell population proliferation | 15488758 |
| Tgene | NTRK1 | GO:0010976 | positive regulation of neuron projection development | 15488758 |
| Tgene | NTRK1 | GO:0018108 | peptidyl-tyrosine phosphorylation | 2927393 |
| Tgene | NTRK1 | GO:0043547 | positive regulation of GTPase activity | 15488758 |
| Tgene | NTRK1 | GO:0046579 | positive regulation of Ras protein signal transduction | 15488758 |
| Tgene | NTRK1 | GO:0046777 | protein autophosphorylation | 15488758 |
| Tgene | NTRK1 | GO:0048011 | neurotrophin TRK receptor signaling pathway | 15488758 |
| Tgene | NTRK1 | GO:0051092 | positive regulation of NF-kappaB transcription factor activity | 15488758 |
| Tgene | NTRK1 | GO:0070374 | positive regulation of ERK1 and ERK2 cascade | 15488758 |
| Tgene | NTRK1 | GO:1904646 | cellular response to amyloid-beta | 11927634 |
| Kinase Fusion gene breakpoints across RPL7A (5'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
 |
| Kinase Fusion gene breakpoints across NTRK1 (3'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
 |
Top |
Kinase Fusion Gene Sample Information |
| Kinase Fusion gene information. |
| Kinase Fusion gene information from four resources (ChiTars 5.0, ChimerDB 4.0, COSMIC, and CCLE) * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
| Source | Sample | Hgene | Hchr | Hbp | Tgene | Tchr | Tbp |
| ChiTaRS5.0 | X06704 | RPL7A | chr9 | 136215897 | NTRK1 | chr1 | 156844362 |
Top |
Kinase Fusion ORF Analysis |
| Kinase Fusion information from ORFfinder translation from full-length transcript sequence from KinaseFusionDB. |
| Henst | Tenst | Hgene | Hchr | Hbp | Tgene | Tchr | Tbp | Seq length (transcript) | Seq length (amino acids) |
| ENST00000323345 | ENST00000392302 | RPL7A | chr9 | 136215897 | NTRK1 | chr1 | 156844362 | 1502 | 439 |
Top |
Kinase Fusion Amino Acid Sequences |
| For individual full-length fusion transcript sequence from KinaseFusionDB, we ran ORFfinder and chose the longest ORF among the all predicted ones. |
| >Henst_Tenst_Hgene_Hchr_Hbp_Tgene_Tchr_Tbp_length(fusion AA)_AAseq >ENST00000323345_ENST00000392302_RPL7A_chr9_136215897_NTRK1_chr1_156844362_length(amino acids)=439 MPKGKKAKGKKVAPAPAVVKKQEAKKVVNPLFEKRPKNFGIDTNSTSGDPVEKKDETPFGVSVAVGLAVFACLFLSTLLLVLNKCGRRNK FGINRPAVLAPEDGLAMSLHFMTLGGSSLSPTEGKGSGLQGHIIENPQYFSDACVHHIKRRDIVLKWELGEGAFGKVFLAECHNLLPEQD KMLVAVKALKEASESARQDFQREAELLTMLQHQHIVRFFGVCTEGRPLLMVFEYMRHGDLNRFLRSHGPDAKLLAGGEDVAPGPLGLGQL LAVASQVAAGMVYLAGLHFVHRDLATRNCLVGQGLVVKIGDFGMSRDIYSTDYYRVGGRTMLPIRWMPPESILYRKFTTESDVWSFGVVL -------------------------------------------------------------- |
Multiple Sequence Alignment of All Fusion Protein Isoforms |
Top |
Kinase Fusion Protein Functional Features |
| Four levels of functional features of fusion genes Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr9:136215897/chr1:156844362) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
 |
| Main function of each fusion partner protein. (from UniProt) |
| Hgene | Tgene |
| RPL7A | NTRK1 |
| FUNCTION: Component of the large ribosomal subunit (PubMed:23636399, PubMed:32669547). The ribosome is a large ribonucleoprotein complex responsible for the synthesis of proteins in the cell (PubMed:23636399, PubMed:32669547). {ECO:0000269|PubMed:23636399, ECO:0000269|PubMed:32669547}. | FUNCTION: Receptor tyrosine kinase involved in the development and the maturation of the central and peripheral nervous systems through regulation of proliferation, differentiation and survival of sympathetic and nervous neurons. High affinity receptor for NGF which is its primary ligand (PubMed:1850821, PubMed:1849459, PubMed:1281417, PubMed:8325889, PubMed:15488758, PubMed:22649032, PubMed:17196528, PubMed:27445338). Can also bind and be activated by NTF3/neurotrophin-3. However, NTF3 only supports axonal extension through NTRK1 but has no effect on neuron survival (By similarity). Upon dimeric NGF ligand-binding, undergoes homodimerization, autophosphorylation and activation (PubMed:1281417). Recruits, phosphorylates and/or activates several downstream effectors including SHC1, FRS2, SH2B1, SH2B2 and PLCG1 that regulate distinct overlapping signaling cascades driving cell survival and differentiation. Through SHC1 and FRS2 activates a GRB2-Ras-MAPK cascade that regulates cell differentiation and survival. Through PLCG1 controls NF-Kappa-B activation and the transcription of genes involved in cell survival. Through SHC1 and SH2B1 controls a Ras-PI3 kinase-AKT1 signaling cascade that is also regulating survival. In absence of ligand and activation, may promote cell death, making the survival of neurons dependent on trophic factors. {ECO:0000250|UniProtKB:P35739, ECO:0000250|UniProtKB:Q3UFB7, ECO:0000269|PubMed:11244088, ECO:0000269|PubMed:1281417, ECO:0000269|PubMed:15488758, ECO:0000269|PubMed:17196528, ECO:0000269|PubMed:1849459, ECO:0000269|PubMed:1850821, ECO:0000269|PubMed:22649032, ECO:0000269|PubMed:27445338, ECO:0000269|PubMed:27676246, ECO:0000269|PubMed:8155326, ECO:0000269|PubMed:8325889}.; FUNCTION: [Isoform TrkA-III]: Resistant to NGF, it constitutively activates AKT1 and NF-kappa-B and is unable to activate the Ras-MAPK signaling cascade. Antagonizes the anti-proliferative NGF-NTRK1 signaling that promotes neuronal precursors differentiation. Isoform TrkA-III promotes angiogenesis and has oncogenic activity when overexpressed. {ECO:0000269|PubMed:15488758}. |
| Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
| - Retained domain in the 5'-partner of fusion protein (protein functional feature from UniProt). |
| Partner | Hgeneene | Hbp | Tgeneene | Tbp | ENST | BPexon | TotalExon | Protein feature loci | BPloci | TotalLen | Feature | Note |
| - Retained domain in the 3'-partner of fusion protein (protein functional feature from UniProt). |
| Partner | Hgeneene | Hbp | Tgeneene | Tbp | ENST | BPexon | TotalExon | Protein feature loci | BPloci | TotalLen | Feature | Note |
| Tgene | RPL7A | 136215897 | NTRK1 | 156844362 | ENST00000323345 | 7 | 16 | 510_781 | 392 | 791 | Domain | Note=Protein kinase;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00159 |
| Tgene | RPL7A | 136215897 | NTRK1 | 156844362 | ENST00000323345 | 8 | 17 | 510_781 | 362 | 761 | Domain | Note=Protein kinase;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00159 |
| Tgene | RPL7A | 136215897 | NTRK1 | 156844362 | ENST00000323345 | 8 | 17 | 510_781 | 398 | 797 | Domain | Note=Protein kinase;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00159 |
Top |
Kinase Fusion Protein Structures |
| CIF files of the predicted kinase fusion proteins * Here we show the 3D structure of the fusion proteins using Mol*. AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Model confidence is shown from the pLDDT values per residue. pLDDT corresponds to the model’s prediction of its score on the local Distance Difference Test. It is a measure of local accuracy (from AlphfaFold website). To color code individual residues, we transformed individual PDB files into CIF format. |
| Kinase Fusion protein CIF link (fusion AA seq ID in KinaseFusionDB) | Henst | Tenst | Hgene | Hchr | Hbp | Tgene | Tchr | Tbp | AA seq | Len(AA seq) |
| PDB file >>>427_RPL7A_NTRK1 | ENST00000323345 | ENST00000392302 | RPL7A | chr9 | 136215897 | NTRK1 | chr1 | 156844362 | MPKGKKAKGKKVAPAPAVVKKQEAKKVVNPLFEKRPKNFGIDTNSTSGDPVEKKDETPFGVSVAVGLAVFACLFLSTLLLVLNKCGRRNK FGINRPAVLAPEDGLAMSLHFMTLGGSSLSPTEGKGSGLQGHIIENPQYFSDACVHHIKRRDIVLKWELGEGAFGKVFLAECHNLLPEQD KMLVAVKALKEASESARQDFQREAELLTMLQHQHIVRFFGVCTEGRPLLMVFEYMRHGDLNRFLRSHGPDAKLLAGGEDVAPGPLGLGQL LAVASQVAAGMVYLAGLHFVHRDLATRNCLVGQGLVVKIGDFGMSRDIYSTDYYRVGGRTMLPIRWMPPESILYRKFTTESDVWSFGVVL | 439 |
| 3D view using mol* of 427_RPL7A_NTRK1 | ||||||||||
| PDB file >>>TKFP_713_RPL7A_NTRK1 | ENST00000323345 | ENST00000392302 | RPL7A | chr9 | 136215897 | NTRK1 | chr1 | 156844362 | MPKGKKAKGKKVAPAPAVVKKQEAKKVVNPLFEKRPKNFGIDTNSTSGDPVEKKDETPFGVSVAVGLAVFACLFLSTLLLVLNKCGRRNK FGINRPAVLAPEDGLAMSLHFMTLGGSSLSPTEGKGSGLQGHIIENPQYFSDACVHHIKRRDIVLKWELGEGAFGKVFLAECHNLLPEQD KMLVAVKALKEASESARQDFQREAELLTMLQHQHIVRFFGVCTEGRPLLMVFEYMRHGDLNRFLRSHGPDAKLLAGGEDVAPGPLGLGQL LAVASQVAAGMVYLAGLHFVHRDLATRNCLVGQGLVVKIGDFGMSRDIYSTDYYRVGGRTMLPIRWMPPESILYRKFTTESDVWSFGVVL | 439_RPL7A_NTRK1 |
Top |
Comparison of Fusion Protein Isoforms |
| Superimpose the 3D Structures Among All Fusion Protein Isoforms * Download the pdb file and open it from the molstar online viewer. |
| Comparison of the Secondary Structures of Fusion Protein Isoforms |
Top |
Comparison of Fusion Protein Sequences/Structures with Known Sequences/Structures from PDB |
Top |
pLDDT score distribution |
| pLDDT score distribution of the predicted fusion protein structures from AlphaFold2 * AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. * The blue color at the bottom marks the best active site residues. |
| 427_RPL7A_NTRK1.png |
 |
| 427_RPL7A_NTRK1.png |
 |
Top |
Potential Active Site Information |
| The potential binding sites of these fusion proteins were identified using SiteMap, a module of the Schrodinger suite. |
| Kinase Fusion AA seq ID in KinaseFusionDB | Site score | Size | Dscore | Volume | Exposure | Enclosure | Contact | Phobic | Philic | Balance | Don/Acc | Residues |
Top |
Ramachandran Plot of Kinase Fusion Protein Structure |
| Ramachandran plot of the torsional angles - phi (φ)and psi (ψ) - of the residues (amino acids) contained in this fusion protein peptide. |
| 427_RPL7A_NTRK1_ramachandran.png |
 |
Top |
Virtual Screening Results |
| Distribution of the average docking score across all approved kinase inhibitors. Distribution of the number of occurrence across all approved kinase inhibitors. |
| 5'-kinase fusion protein case |
| 3'-kinase fusion protein case |
Top |
| Drug information from DrugBank of the top 20 interacting small molecules. * The detailed information of individual kinase inhibitors are available in the download page. |
| Fusion gene name info | Drug | Docking score | Glide g score | Glide energy |
Top |
Kinase-Substrate Information of RPL7A_NTRK1 |
| Phosphorylation target of the kinase (phosphosite, 03-17-2024) |
| Kinase | Kinase UniProt Acc | Kinase species | Substrate | Substrate UniProt Acc | Substrate phosphorylated residues | Substrate phosphorylated sites (+/-7AA) | Domain |
| NTRK1 | P04629 | human | SH2B1 | Q9NRF2 | Y753 | PRAINNQySFV____ | |
| NTRK1 | P04629 | human | CTNNB1 | P35222 | Y142 | AVVNLINyQDDAELA | |
| NTRK1 | P04629 | human | NTRK1 | P04629-2 | Y490 | HIIENPQyFSDACVH | |
| NTRK1 | P04629 | human | NTRK1 | P04629-2 | Y674 | RDIySTDyyRVGGRT | PK_Tyr_Ser-Thr |
| NTRK1 | P04629 | human | NTRK1 | P04629 | Y680 | RDIySTDyyRVGGRT | PK_Tyr_Ser-Thr |
| NTRK1 | P04629 | human | SHC3 | Q92529-2 | Y218 | GDGSDHPyyNSIPSK | |
| NTRK1 | P04629 | human | SHC3 | Q92529-2 | Y256 | FAGKEQTyyQGRHLG | |
| NTRK1 | P04629 | human | NTRK1 | P04629-2 | Y670 | FGMSRDIySTDyyRV | PK_Tyr_Ser-Thr |
| NTRK1 | P04629 | human | NTRK1 | P04629 | Y496 | HIIENPQyFSDACVH | |
| NTRK1 | P04629 | human | STAT3 | P40763 | Y705 | DPGsAAPyLktKFIC | |
| NTRK1 | P04629 | human | SHC1 | P29353-2 | Y317 | ELFDDPSyVNVQNLD | |
| NTRK1 | P04629 | human | PLCG1 | P19174 | Y771 | IGtAEPdyGALyEGR | |
| NTRK1 | P04629 | human | PLCG1 | P19174 | Y783 | EGRNPGFyVEANPMP | |
| NTRK1 | P04629 | human | NTRK1 | P04629-2 | Y675 | DIySTDyyRVGGRTM | PK_Tyr_Ser-Thr |
| NTRK1 | P04629 | human | NTRK1 | P04629-2 | Y751 | RACPPEVyAIMRGCW | PK_Tyr_Ser-Thr |
| NTRK1 | P04629 | human | NTRK1 | P04629 | Y681 | DIySTDyyRVGGRTM | PK_Tyr_Ser-Thr |
| NTRK1 | P04629 | human | NTRK1 | P04629-2 | Y785 | LAQAPPVyLDVLG__ | |
| NTRK1 | P04629 | human | SHC3 | Q92529-2 | Y301 | PTGEAPTyVNTQQIP | |
| NTRK1 | P04629 | human | SHC3 | Q92529-2 | Y257 | AGKEQTyyQGRHLGD | |
| NTRK1 | P04629 | human | SHC3 | Q92529-2 | Y283 | RQGSSDIySTPEGKL | |
| NTRK1 | P04629 | human | SHC3 | Q92529-2 | Y219 | DGSDHPyyNSIPSKM |
| Biological Network Integration of This Kinase and Substrates (GeneMANIA website) |
| Enriched GO biological processes of the phosphorylation target genes of the kinase |
| Kinase | GOID | GO term | P.adjust |
| NTRK1 | ID | Description | 0.00e+00 |
| NTRK1 | GO:0007173 | epidermal growth factor receptor signaling pathway | 3.89e-03 |
| NTRK1 | GO:0038127 | ERBB signaling pathway | 3.89e-03 |
| NTRK1 | GO:0048485 | sympathetic nervous system development | 7.40e-03 |
| NTRK1 | GO:1905564 | positive regulation of vascular endothelial cell proliferation | 8.42e-03 |
| NTRK1 | GO:0050679 | positive regulation of epithelial cell proliferation | 8.42e-03 |
| NTRK1 | GO:0051091 | positive regulation of DNA-binding transcription factor activity | 9.81e-03 |
| NTRK1 | GO:0048483 | autonomic nervous system development | 1.32e-02 |
| NTRK1 | GO:0101023 | vascular endothelial cell proliferation | 1.32e-02 |
| NTRK1 | GO:1905562 | regulation of vascular endothelial cell proliferation | 1.32e-02 |
| NTRK1 | GO:0050982 | detection of mechanical stimulus | 1.32e-02 |
| NTRK1 | GO:0045765 | regulation of angiogenesis | 1.43e-02 |
| NTRK1 | GO:1901342 | regulation of vasculature development | 1.43e-02 |
| NTRK1 | GO:0021545 | cranial nerve development | 1.43e-02 |
| NTRK1 | GO:0051090 | regulation of DNA-binding transcription factor activity | 1.78e-02 |
| NTRK1 | GO:0050678 | regulation of epithelial cell proliferation | 1.78e-02 |
| NTRK1 | GO:0030098 | lymphocyte differentiation | 1.95e-02 |
| NTRK1 | GO:0043410 | positive regulation of MAPK cascade | 2.21e-02 |
| NTRK1 | GO:0050673 | epithelial cell proliferation | 2.21e-02 |
| NTRK1 | GO:1903131 | mononuclear cell differentiation | 2.21e-02 |
| NTRK1 | GO:0021675 | nerve development | 2.21e-02 |
| NTRK1 | GO:0001938 | positive regulation of endothelial cell proliferation | 2.65e-02 |
| NTRK1 | GO:0032355 | response to estradiol | 2.65e-02 |
| NTRK1 | GO:0051963 | regulation of synapse assembly | 2.65e-02 |
| NTRK1 | GO:2000278 | regulation of DNA biosynthetic process | 2.67e-02 |
| NTRK1 | GO:0048593 | camera-type eye morphogenesis | 3.31e-02 |
| NTRK1 | GO:0009581 | detection of external stimulus | 3.42e-02 |
| NTRK1 | GO:0009582 | detection of abiotic stimulus | 3.44e-02 |
| NTRK1 | GO:0051092 | positive regulation of NF-kappaB transcription factor activity | 3.62e-02 |
| NTRK1 | GO:0048592 | eye morphogenesis | 3.62e-02 |
| NTRK1 | GO:0043524 | negative regulation of neuron apoptotic process | 3.62e-02 |
| NTRK1 | GO:0046661 | male sex differentiation | 3.62e-02 |
| NTRK1 | GO:0001764 | neuron migration | 3.62e-02 |
| NTRK1 | GO:0001936 | regulation of endothelial cell proliferation | 3.62e-02 |
| NTRK1 | GO:0019827 | stem cell population maintenance | 3.62e-02 |
| NTRK1 | GO:0045766 | positive regulation of angiogenesis | 3.62e-02 |
| NTRK1 | GO:1904018 | positive regulation of vasculature development | 3.62e-02 |
| NTRK1 | GO:0098727 | maintenance of cell number | 3.62e-02 |
| NTRK1 | GO:0071897 | DNA biosynthetic process | 3.62e-02 |
| NTRK1 | GO:0007416 | synapse assembly | 3.62e-02 |
| NTRK1 | GO:0001935 | endothelial cell proliferation | 3.62e-02 |
| NTRK1 | GO:0050728 | negative regulation of inflammatory response | 3.62e-02 |
| NTRK1 | GO:0009612 | response to mechanical stimulus | 3.62e-02 |
| NTRK1 | GO:0045637 | regulation of myeloid cell differentiation | 3.62e-02 |
| NTRK1 | GO:1901888 | regulation of cell junction assembly | 3.62e-02 |
| NTRK1 | GO:0070374 | positive regulation of ERK1 and ERK2 cascade | 3.62e-02 |
| NTRK1 | GO:0043523 | regulation of neuron apoptotic process | 3.62e-02 |
| NTRK1 | GO:0050807 | regulation of synapse organization | 3.62e-02 |
| NTRK1 | GO:0048863 | stem cell differentiation | 3.62e-02 |
| NTRK1 | GO:0050803 | regulation of synapse structure or activity | 3.62e-02 |
Top |
Related Drugs to RPL7A_NTRK1 |
| Drugs used for this fusion-positive patient. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
| Hgene | Tgene | Drug | Source | PMID |
| Distribution of the number of studies mentioning RPL7A-NTRK1 and kinase inhibitors the PubMed Abstract (04-01-2024) |
| Fusion gene - drug pair 1 | Fusion gene - drug pair 2 | PMID | Publication date | DOI | Study title |
Top |
Related Diseases to RPL7A_NTRK1 |
| Diseases that have this fusion gene. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
| Hgene | Tgene | Disease | Source | PMID |
| Related diseases from the literature mentioned this fusion gene and drug. (PubMed, 04-01-2024) |
| MeSH ID | MeSH term |
| Diseases associated with fusion partners. (DisGeNet 4.0) |
| Partner | Gene | Disease ID | Disease name | # pubmeds | Source |
| Tgene | NTRK1 | C0020074 | HSAN Type IV | 17 | CTD_human;GENOMICS_ENGLAND;UNIPROT |
| Tgene | NTRK1 | C0238463 | Papillary thyroid carcinoma | 3 | ORPHANET |
Top |
Clinical Trials of the Found Drugs/Small Molecules |
| Statistics of the Clinical Trials of the Found Kinase Inibitors from clinicaltrials.gov (06-17-2024) |
| Clinical Trials from clinicaltrials.gov (06-17-2024) |
| Fusion Gene | Kinase Inhibitor | NCT ID | Study Status | Phases | Disease | # Enrolment | Date |
Copyright 2024-Present -The University of Texas Health Science Center at Houston
Web File Viewing | Emergency Information |Campus Carry|Site Policies |