UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
|
Kinase Fusion Gene:SPECC1L_RET |
Kinase Fusion Protein Summary |
Kinase Fusion gene summary |
Kinase Fusion partner gene information | Kinase Fusion gene name: SPECC1L_RET | KinaseFusionDB ID: KFG6008 | FusionGDB2.0 ID: KFG6008 | Hgene | Tgene | Gene symbol | SPECC1L | RET | Gene ID | 23384 | 5979 | |
Gene name | sperm antigen with calponin homology and coiled-coil domains 1 like | ret proto-oncogene | ||||||||||
Synonyms | CYTSA|GBBB2|OBLFC1|TBHS|TBHS1 | CDHF12|CDHR16|HSCR1|MEN2A|MEN2B|MTC1|PTC|RET-ELE1 | ||||||||||
Cytomap | 22q11.23 | 10q11.21 | ||||||||||
Type of gene | protein-coding | protein-coding | ||||||||||
Description | cytospin-ASPECC1-like proteincytokinesis and spindle organization Arenal carcinoma antigen NY-REN-22 | proto-oncogene tyrosine-protein kinase receptor RetRET receptor tyrosine kinasecadherin family member 12cadherin-related family member 16proto-oncogene c-Retrearranged during transfectionret proto-oncogene (multiple endocrine neoplasia and medullary | ||||||||||
Modification date | 20240305 | 20240416 | ||||||||||
UniProtAcc | Q69YQ0 | P07949 | ||||||||||
Ensembl transtripts involved in fusion gene | ENST ids | ENST00000314328, ENST00000437398, ENST00000541492, ENST00000416735, | ENST00000340058, ENST00000355710, | |||||||||
Context (manual curation of fusion genes in KinaseFusionDB) | PubMed: SPECC1L [Title/Abstract] AND RET [Title/Abstract] AND fusion [Title/Abstract] | |||||||||||
Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) | SPECC1L(24734445)-RET(43612032), # samples:3 |
Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
Partner | Gene | GO ID | GO term | PubMed ID |
Hgene | SPECC1L | GO:0007155 | cell adhesion | 21703590 |
Tgene | RET | GO:0030155 | regulation of cell adhesion | 21357690 |
Tgene | RET | GO:0030335 | positive regulation of cell migration | 20702524 |
Tgene | RET | GO:0033619 | membrane protein proteolysis | 21357690 |
Tgene | RET | GO:0033630 | positive regulation of cell adhesion mediated by integrin | 20702524 |
Tgene | RET | GO:0035860 | glial cell-derived neurotrophic factor receptor signaling pathway | 24560924|25242331|28953886|31535977 |
Tgene | RET | GO:0043410 | positive regulation of MAPK cascade | 28846099 |
Kinase Fusion gene breakpoints across SPECC1L (5'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Kinase Fusion gene breakpoints across RET (3'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Top |
Kinase Fusion Gene Sample Information |
Kinase Fusion gene information. |
Kinase Fusion gene information from four resources (ChiTars 5.0, ChimerDB 4.0, COSMIC, and CCLE) * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
Source | Sample | Hgene | Hchr | Hbp | Tgene | Tchr | Tbp |
ChimerDB4 | TCGA-CE-A485-01A | SPECC1L | chr22 | 24734445 | RET | chr10 | 43612032 |
Top |
Kinase Fusion ORF Analysis |
Kinase Fusion information from ORFfinder translation from full-length transcript sequence from KinaseFusionDB. |
Henst | Tenst | Hgene | Hchr | Hbp | Tgene | Tchr | Tbp | Seq length (transcript) | Seq length (amino acids) |
ENST00000437398 | ENST00000355710 | SPECC1L | chr22 | 24734445 | RET | chr10 | 43612032 | 6146 | 1322 |
Top |
Kinase Fusion Amino Acid Sequences |
For individual full-length fusion transcript sequence from KinaseFusionDB, we ran ORFfinder and chose the longest ORF among the all predicted ones. |
>Henst_Tenst_Hgene_Hchr_Hbp_Tgene_Tchr_Tbp_length(fusion AA)_AAseq >ENST00000437398_ENST00000355710_SPECC1L_chr22_24734445_RET_chr10_43612032_length(amino acids)=1322 MSHRVSSPPSPNQEIARERCGAARFACKCITKRQPRMKKASRSVGSVPKVSAISKTQTAEKIKPENSSSASTGGKLVKPGTAASLSKTKS SDDLLAGMAGGVTVTNGVKGKKSTCPSAAPSASAPAMTTVENKSKISTGTASSTKRSTSTGNKESSSTRERLRERTRLNQSKKLPSAGQG ANDMALAKRSRSRTATECDVRMSKSKSDNQISDRAALEAKVKDLLTLAKTKDVEILHLRNELRDMRAQLGINEDHSEGDEKSEKETIMAH QPTDVESTLLQLQEQNTAIREELNQLKNENRMLKDRLNALGFSLEQRLDNSEKLFGYQSLSPEITPDNQSDGGGTLTSSVEGSAPGSVED LLSQDENTLMDHQHSNSMDNLDSECSEVYQPLTSSDDALDAPSSSESEGIPSIERSRKGSSGNASEVSVACLTERIHQMEENQHSTSEEL QATLQELADLQQITQELNSENERLGEEKVILMESLCQQSDKLEHFSRQIEYFRSLLDEHHISYVIDEDVKSGRYMELEQRYMDLAENARF EREQLLGVQQHLSNTLKMAEQDNKEAQEMIGALKERSHHMERIIESEQKGKAALAATLEEYKATVASDQIEMNRLKAQLENEKQKVAELY SIHNSGDKSDIQDLLESVRLDKEKAETLASSLQEDLAHTRNDANRLQDAIAKVEDEYRAFQEEAKKQIEDLNMTLEKLRSDLDEKETERS DMKETIFELEDEVEQHRAVKLHDNLIISDLENTVKKLQDQKHDMEREIKTLHRRLREESAEWRQFQADLQTAVVIANDIKSEAQEEIGDL KRRLHEAQEKNEKLTKELEEIKSRKQEEERGRVYNYMNAVERDLAALRQGMGLSRRSSTSSEPTPTVKTLIKSFDSASQVPNPAAAAIPR TPLSPSPMKTPPAAAVSPMQEDPKWEFPRKNLVLGKTLGEGEFGKVVKATAFHLKGRAGYTTVAVKMLKENASPSELRDLLSEFNVLKQV NHPHVIKLYGACSQDGPLLLIVEYAKYGSLRGFLRESRKVGPGYLGSGGSRNSSSLDHPDERALTMGDLISFAWQISQGMQYLAEMKLVH RDLAARNILVAEGRKMKISDFGLSRDVYEEDSYVKRSQGRIPVKWMAIESLFDHIYTTQSDVWSFGVLLWEIVTLGGNPYPGIPPERLFN LLKTGHRMERPDNCSEEMYRLMLQCWKQEPDKRPVFADISKDLEKMMVKRRDYLDLAASTPSDSLIYDDGLSEEETPLVDCNNAPLPRAL -------------------------------------------------------------- |
Multiple Sequence Alignment of All Fusion Protein Isoforms |
Top |
Kinase Fusion Protein Functional Features |
Four levels of functional features of fusion genes Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr22:24734445/chr10:43612032) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
Main function of each fusion partner protein. (from UniProt) |
Hgene | Tgene |
SPECC1L | RET |
FUNCTION: Involved in cytokinesis and spindle organization. May play a role in actin cytoskeleton organization and microtubule stabilization and hence required for proper cell adhesion and migration. {ECO:0000269|PubMed:21703590}. | FUNCTION: Receptor tyrosine-protein kinase involved in numerous cellular mechanisms including cell proliferation, neuronal navigation, cell migration, and cell differentiation upon binding with glial cell derived neurotrophic factor family ligands. Phosphorylates PTK2/FAK1. Regulates both cell death/survival balance and positional information. Required for the molecular mechanisms orchestration during intestine organogenesis; involved in the development of enteric nervous system and renal organogenesis during embryonic life, and promotes the formation of Peyer's patch-like structures, a major component of the gut-associated lymphoid tissue. Modulates cell adhesion via its cleavage by caspase in sympathetic neurons and mediates cell migration in an integrin (e.g. ITGB1 and ITGB3)-dependent manner. Involved in the development of the neural crest. Active in the absence of ligand, triggering apoptosis through a mechanism that requires receptor intracellular caspase cleavage. Acts as a dependence receptor; in the presence of the ligand GDNF in somatotrophs (within pituitary), promotes survival and down regulates growth hormone (GH) production, but triggers apoptosis in absence of GDNF. Regulates nociceptor survival and size. Triggers the differentiation of rapidly adapting (RA) mechanoreceptors. Mediator of several diseases such as neuroendocrine cancers; these diseases are characterized by aberrant integrins-regulated cell migration. Mediates, through interaction with GDF15-receptor GFRAL, GDF15-induced cell-signaling in the brainstem which induces inhibition of food-intake. Activates MAPK- and AKT-signaling pathways (PubMed:28846097, PubMed:28953886, PubMed:28846099). Isoform 1 in complex with GFRAL induces higher activation of MAPK-signaling pathway than isoform 2 in complex with GFRAL (PubMed:28846099). {ECO:0000269|PubMed:20064382, ECO:0000269|PubMed:20616503, ECO:0000269|PubMed:20702524, ECO:0000269|PubMed:21357690, ECO:0000269|PubMed:21454698, ECO:0000269|PubMed:28846097, ECO:0000269|PubMed:28846099, ECO:0000269|PubMed:28953886}. |
Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
- Retained domain in the 5'-partner of fusion protein (protein functional feature from UniProt). |
Partner | Hgeneene | Hbp | Tgeneene | Tbp | ENST | BPexon | TotalExon | Protein feature loci | BPloci | TotalLen | Feature | Note |
- Retained domain in the 3'-partner of fusion protein (protein functional feature from UniProt). |
Partner | Hgeneene | Hbp | Tgeneene | Tbp | ENST | BPexon | TotalExon | Protein feature loci | BPloci | TotalLen | Feature | Note |
Tgene | SPECC1L | 24734445 | RET | 43612032 | ENST00000437398 | 10 | 19 | 724_1016 | 712 | 1073 | Domain | Note=Protein kinase;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00159 |
Tgene | SPECC1L | 24734445 | RET | 43612032 | ENST00000437398 | 10 | 20 | 724_1016 | 712 | 1115 | Domain | Note=Protein kinase;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00159 |
Top |
Kinase Fusion Protein Structures |
CIF files of the predicted kinase fusion proteins * Here we show the 3D structure of the fusion proteins using Mol*. AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Model confidence is shown from the pLDDT values per residue. pLDDT corresponds to the model’s prediction of its score on the local Distance Difference Test. It is a measure of local accuracy (from AlphfaFold website). To color code individual residues, we transformed individual PDB files into CIF format. |
Kinase Fusion protein CIF link (fusion AA seq ID in KinaseFusionDB) | Henst | Tenst | Hgene | Hchr | Hbp | Tgene | Tchr | Tbp | AA seq | Len(AA seq) |
PDB file >>>466_SPECC1L_RET | ENST00000437398 | ENST00000355710 | SPECC1L | chr22 | 24734445 | RET | chr10 | 43612032 | MSHRVSSPPSPNQEIARERCGAARFACKCITKRQPRMKKASRSVGSVPKVSAISKTQTAEKIKPENSSSASTGGKLVKPGTAASLSKTKS SDDLLAGMAGGVTVTNGVKGKKSTCPSAAPSASAPAMTTVENKSKISTGTASSTKRSTSTGNKESSSTRERLRERTRLNQSKKLPSAGQG ANDMALAKRSRSRTATECDVRMSKSKSDNQISDRAALEAKVKDLLTLAKTKDVEILHLRNELRDMRAQLGINEDHSEGDEKSEKETIMAH QPTDVESTLLQLQEQNTAIREELNQLKNENRMLKDRLNALGFSLEQRLDNSEKLFGYQSLSPEITPDNQSDGGGTLTSSVEGSAPGSVED LLSQDENTLMDHQHSNSMDNLDSECSEVYQPLTSSDDALDAPSSSESEGIPSIERSRKGSSGNASEVSVACLTERIHQMEENQHSTSEEL QATLQELADLQQITQELNSENERLGEEKVILMESLCQQSDKLEHFSRQIEYFRSLLDEHHISYVIDEDVKSGRYMELEQRYMDLAENARF EREQLLGVQQHLSNTLKMAEQDNKEAQEMIGALKERSHHMERIIESEQKGKAALAATLEEYKATVASDQIEMNRLKAQLENEKQKVAELY SIHNSGDKSDIQDLLESVRLDKEKAETLASSLQEDLAHTRNDANRLQDAIAKVEDEYRAFQEEAKKQIEDLNMTLEKLRSDLDEKETERS DMKETIFELEDEVEQHRAVKLHDNLIISDLENTVKKLQDQKHDMEREIKTLHRRLREESAEWRQFQADLQTAVVIANDIKSEAQEEIGDL KRRLHEAQEKNEKLTKELEEIKSRKQEEERGRVYNYMNAVERDLAALRQGMGLSRRSSTSSEPTPTVKTLIKSFDSASQVPNPAAAAIPR TPLSPSPMKTPPAAAVSPMQEDPKWEFPRKNLVLGKTLGEGEFGKVVKATAFHLKGRAGYTTVAVKMLKENASPSELRDLLSEFNVLKQV NHPHVIKLYGACSQDGPLLLIVEYAKYGSLRGFLRESRKVGPGYLGSGGSRNSSSLDHPDERALTMGDLISFAWQISQGMQYLAEMKLVH RDLAARNILVAEGRKMKISDFGLSRDVYEEDSYVKRSQGRIPVKWMAIESLFDHIYTTQSDVWSFGVLLWEIVTLGGNPYPGIPPERLFN LLKTGHRMERPDNCSEEMYRLMLQCWKQEPDKRPVFADISKDLEKMMVKRRDYLDLAASTPSDSLIYDDGLSEEETPLVDCNNAPLPRAL | 1322 |
3D view using mol* of 466_SPECC1L_RET | ||||||||||
PDB file >>>TKFP_793_SPECC1L_RET | ENST00000437398 | ENST00000355710 | SPECC1L | chr22 | 24734445 | RET | chr10 | 43612032 | MSHRVSSPPSPNQEIARERCGAARFACKCITKRQPRMKKASRSVGSVPKVSAISKTQTAEKIKPENSSSASTGGKLVKPGTAASLSKTKS SDDLLAGMAGGVTVTNGVKGKKSTCPSAAPSASAPAMTTVENKSKISTGTASSTKRSTSTGNKESSSTRERLRERTRLNQSKKLPSAGQG ANDMALAKRSRSRTATECDVRMSKSKSDNQISDRAALEAKVKDLLTLAKTKDVEILHLRNELRDMRAQLGINEDHSEGDEKSEKETIMAH QPTDVESTLLQLQEQNTAIREELNQLKNENRMLKDRLNALGFSLEQRLDNSEKLFGYQSLSPEITPDNQSDGGGTLTSSVEGSAPGSVED LLSQDENTLMDHQHSNSMDNLDSECSEVYQPLTSSDDALDAPSSSESEGIPSIERSRKGSSGNASEVSVACLTERIHQMEENQHSTSEEL QATLQELADLQQITQELNSENERLGEEKVILMESLCQQSDKLEHFSRQIEYFRSLLDEHHISYVIDEDVKSGRYMELEQRYMDLAENARF EREQLLGVQQHLSNTLKMAEQDNKEAQEMIGALKERSHHMERIIESEQKGKAALAATLEEYKATVASDQIEMNRLKAQLENEKQKVAELY SIHNSGDKSDIQDLLESVRLDKEKAETLASSLQEDLAHTRNDANRLQDAIAKVEDEYRAFQEEAKKQIEDLNMTLEKLRSDLDEKETERS DMKETIFELEDEVEQHRAVKLHDNLIISDLENTVKKLQDQKHDMEREIKTLHRRLREESAEWRQFQADLQTAVVIANDIKSEAQEEIGDL KRRLHEAQEKNEKLTKELEEIKSRKQEEERGRVYNYMNAVERDLAALRQGMGLSRRSSTSSEPTPTVKTLIKSFDSASQVPNPAAAAIPR TPLSPSPMKTPPAAAVSPMQEDPKWEFPRKNLVLGKTLGEGEFGKVVKATAFHLKGRAGYTTVAVKMLKENASPSELRDLLSEFNVLKQV NHPHVIKLYGACSQDGPLLLIVEYAKYGSLRGFLRESRKVGPGYLGSGGSRNSSSLDHPDERALTMGDLISFAWQISQGMQYLAEMKLVH RDLAARNILVAEGRKMKISDFGLSRDVYEEDSYVKRSQGRIPVKWMAIESLFDHIYTTQSDVWSFGVLLWEIVTLGGNPYPGIPPERLFN LLKTGHRMERPDNCSEEMYRLMLQCWKQEPDKRPVFADISKDLEKMMVKRRDYLDLAASTPSDSLIYDDGLSEEETPLVDCNNAPLPRAL | 1322_SPECC1L_RET |
Top |
Comparison of Fusion Protein Isoforms |
Superimpose the 3D Structures Among All Fusion Protein Isoforms * Download the pdb file and open it from the molstar online viewer. |
Comparison of the Secondary Structures of Fusion Protein Isoforms |
Top |
Comparison of Fusion Protein Sequences/Structures with Known Sequences/Structures from PDB |
Top |
pLDDT score distribution |
pLDDT score distribution of the predicted fusion protein structures from AlphaFold2 * AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. * The blue color at the bottom marks the best active site residues. |
466_SPECC1L_RET.png |
466_SPECC1L_RET.png |
Top |
Potential Active Site Information |
The potential binding sites of these fusion proteins were identified using SiteMap, a module of the Schrodinger suite. |
Kinase Fusion AA seq ID in KinaseFusionDB | Site score | Size | Dscore | Volume | Exposure | Enclosure | Contact | Phobic | Philic | Balance | Don/Acc | Residues |
Top |
Ramachandran Plot of Kinase Fusion Protein Structure |
Ramachandran plot of the torsional angles - phi (φ)and psi (ψ) - of the residues (amino acids) contained in this fusion protein peptide. |
466_SPECC1L_RET_ramachandran.png |
Top |
Virtual Screening Results |
Distribution of the average docking score across all approved kinase inhibitors. Distribution of the number of occurrence across all approved kinase inhibitors. |
5'-kinase fusion protein case |
3'-kinase fusion protein case |
Top |
Drug information from DrugBank of the top 20 interacting small molecules. * The detailed information of individual kinase inhibitors are available in the download page. |
Fusion gene name info | Drug | Docking score | Glide g score | Glide energy |
Top |
Kinase-Substrate Information of SPECC1L_RET |
Phosphorylation target of the kinase (phosphosite, 03-17-2024) |
Kinase | Kinase UniProt Acc | Kinase species | Substrate | Substrate UniProt Acc | Substrate phosphorylated residues | Substrate phosphorylated sites (+/-7AA) | Domain |
RET | Q15300 | human | STAT3 | P40763 | Y705 | DPGsAAPyLktKFIC | |
RET | Q15300 | human | RET | Q15300 | Y586 | TWIENKLyGRISHAF | |
RET | P07949 | human | RET | P07949 | Y981 | DNCSEEMyRLMLQCW | PK_Tyr_Ser-Thr |
RET | P07949 | human | PTK2 | Q05397 | Y925 | DRsNDkVyENVtGLV | Focal_AT |
RET | P07949 | human | RET | P07949 | Y1090 | TNTGFPRyPNDSVyA | |
RET | P07949 | human | ATF4 | P18848 | T107 | LGIDDLEtMPDDLLt | |
RET | P07949 | human | PTK2 | Q05397 | Y577 | yMEDstyyKAsKGKL | PK_Tyr_Ser-Thr |
RET | P07949 | human | ATF4 | P18848 | T115 | MPDDLLttLDDtCDL | |
RET | P07949 | human | MAPK9 | P45984 | Y185 | tNFMMtPyVVtRYYR | Pkinase |
RET | P07949 | human | RET | P07949 | Y1096 | RyPNDSVyANWMLSP | |
RET | P07949 | human | MAPK8 | P45983 | Y185 | tsFMMtPyVVtRYYR | Pkinase |
RET | P07949 | human | PIK3R1 | P27986 | Y203 | PVIPAAVySEMIsLA | RhoGAP |
RET | P07949 | human | RET | P07949 | Y826 | SRKVGPGyLGSGGSR | PK_Tyr_Ser-Thr |
RET | P07949 | human | RET | P07949 | Y1015 | MMVKRRDyLDLAAST | |
RET | P07949 | human | PDPK1 | O15530 | Y9 | ARTTSQLyDAVPIQS | |
RET | P07949 | human | ATF4 | P18848 | T114 | tMPDDLLttLDDtCD | |
RET | P07949 | human | DOK1 | Q99704 | Y398 | ARVkEEGyELPyNPA | |
RET | P07949 | human | RET | P07949 | Y809 | LIVEyAKyGSLRGFL | PK_Tyr_Ser-Thr |
RET | P07949 | human | PTK2 | Q05397 | Y861 | PIGNQHIyQPVGKPD | |
RET | P07949 | human | ATF4 | P18848 | T119 | LLttLDDtCDLFAPL | |
RET | P07949 | human | RET | P07949 | Y1029 | TPSDSLIyDDGLSEE | |
RET | P07949 | human | RET | P07949 | Y687 | AQAFPVsysSSGARR | |
RET | P07949 | human | PLCG1 | P19174 | Y783 | EGRNPGFyVEANPMP | |
RET | P07949 | human | MAPK3 | P27361 | T202 | HDHtGFLtEyVAtRW | Pkinase |
RET | P07949 | human | AFAP1L2 | Q8N4X5 | Y54 | SSSsDEEyIyMNKVt | |
RET | P07949 | human | AKT1 | P31749 | Y315 | tFCGtPEyLAPEVLE | Pkinase |
RET | P07949 | human | RET | P07949 | Y806 | PLLLIVEyAKyGSLR | PK_Tyr_Ser-Thr |
RET | P07949 | human | RET | P07949 | Y900 | FGLSRDVyEEDsyVK | PK_Tyr_Ser-Thr |
RET | P07949 | human | MAPK1 | P28482 | Y187 | HtGFLtEyVAtRWyr | Pkinase |
RET | P07949 | human | RET | P07949 | Y905 | DVyEEDsyVKRsQGR | PK_Tyr_Ser-Thr |
RET | P07949 | human | PTK2 | Q05397 | Y576 | RyMEDstyyKAsKGK | PK_Tyr_Ser-Thr |
RET | P07949 | human | MAPK3 | P27361 | Y204 | HtGFLtEyVAtRWyr | Pkinase |
RET | P07949 | human | RET | P07949 | Y1062 | TWIENkLyGMsDPNW | |
RET | P07949 | human | MAPK14 | Q16539 | Y182 | tDDEMtGyVAtRWYR | Pkinase |
Biological Network Integration of This Kinase and Substrates (GeneMANIA website) |
Enriched GO biological processes of the phosphorylation target genes of the kinase |
Kinase | GOID | GO term | P.adjust |
RET | ID | Description | 0.00e+00 |
RET | GO:0071276 | cellular response to cadmium ion | 8.65e-08 |
RET | GO:0070849 | response to epidermal growth factor | 1.02e-07 |
RET | GO:0038127 | ERBB signaling pathway | 1.02e-07 |
RET | GO:0043434 | response to peptide hormone | 1.02e-07 |
RET | GO:0048009 | insulin-like growth factor receptor signaling pathway | 1.02e-07 |
RET | GO:0046686 | response to cadmium ion | 1.64e-07 |
RET | GO:0018105 | peptidyl-serine phosphorylation | 2.35e-07 |
RET | GO:0018209 | peptidyl-serine modification | 2.58e-07 |
RET | GO:0071375 | cellular response to peptide hormone stimulus | 2.58e-07 |
RET | GO:0071248 | cellular response to metal ion | 7.74e-07 |
RET | GO:1901653 | cellular response to peptide | 7.74e-07 |
RET | GO:0071241 | cellular response to inorganic substance | 1.52e-06 |
RET | GO:0007173 | epidermal growth factor receptor signaling pathway | 1.57e-06 |
RET | GO:0060416 | response to growth hormone | 1.79e-06 |
RET | GO:0034599 | cellular response to oxidative stress | 2.31e-06 |
RET | GO:0008286 | insulin receptor signaling pathway | 2.80e-06 |
RET | GO:0032868 | response to insulin | 2.80e-06 |
RET | GO:0002764 | immune response-regulating signaling pathway | 3.49e-06 |
RET | GO:0043491 | phosphatidylinositol 3-kinase/protein kinase B signal transduction | 3.92e-06 |
RET | GO:0034198 | cellular response to amino acid starvation | 4.22e-06 |
RET | GO:1990928 | response to amino acid starvation | 5.08e-06 |
RET | GO:0009411 | response to UV | 5.10e-06 |
RET | GO:0038093 | Fc receptor signaling pathway | 5.10e-06 |
RET | GO:0062197 | cellular response to chemical stress | 5.10e-06 |
RET | GO:0034614 | cellular response to reactive oxygen species | 5.10e-06 |
RET | GO:0031663 | lipopolysaccharide-mediated signaling pathway | 5.49e-06 |
RET | GO:0061517 | macrophage proliferation | 5.72e-06 |
RET | GO:0002768 | immune response-regulating cell surface receptor signaling pathway | 7.56e-06 |
RET | GO:0010038 | response to metal ion | 9.07e-06 |
RET | GO:0050900 | leukocyte migration | 1.56e-05 |
RET | GO:0006979 | response to oxidative stress | 1.59e-05 |
RET | GO:0010759 | positive regulation of macrophage chemotaxis | 1.59e-05 |
RET | GO:0000302 | response to reactive oxygen species | 1.59e-05 |
RET | GO:0032869 | cellular response to insulin stimulus | 1.59e-05 |
RET | GO:0071674 | mononuclear cell migration | 1.59e-05 |
RET | GO:0051347 | positive regulation of transferase activity | 1.69e-05 |
RET | GO:0034764 | positive regulation of transmembrane transport | 1.90e-05 |
RET | GO:0071222 | cellular response to lipopolysaccharide | 2.26e-05 |
RET | GO:0001503 | ossification | 2.28e-05 |
RET | GO:0002685 | regulation of leukocyte migration | 2.28e-05 |
RET | GO:0051403 | stress-activated MAPK cascade | 2.28e-05 |
RET | GO:0031098 | stress-activated protein kinase signaling cascade | 2.63e-05 |
RET | GO:0071219 | cellular response to molecule of bacterial origin | 2.63e-05 |
RET | GO:0038095 | Fc-epsilon receptor signaling pathway | 2.75e-05 |
RET | GO:0060396 | growth hormone receptor signaling pathway | 2.75e-05 |
RET | GO:0018107 | peptidyl-threonine phosphorylation | 2.76e-05 |
RET | GO:0048863 | stem cell differentiation | 2.76e-05 |
RET | GO:0002757 | immune response-activating signaling pathway | 2.76e-05 |
RET | GO:0071378 | cellular response to growth hormone stimulus | 2.79e-05 |
Top |
Related Drugs to SPECC1L_RET |
Drugs used for this fusion-positive patient. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Drug | Source | PMID |
Distribution of the number of studies mentioning SPECC1L-RET and kinase inhibitors the PubMed Abstract (04-01-2024) |
Fusion gene - drug pair 1 | Fusion gene - drug pair 2 | PMID | Publication date | DOI | Study title |
Top |
Related Diseases to SPECC1L_RET |
Diseases that have this fusion gene. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Disease | Source | PMID |
Related diseases from the literature mentioned this fusion gene and drug. (PubMed, 04-01-2024) |
MeSH ID | MeSH term |
Diseases associated with fusion partners. (DisGeNet 4.0) |
Partner | Gene | Disease ID | Disease name | # pubmeds | Source |
Tgene | RET | C1833921 | Familial medullary thyroid carcinoma | 23 | CTD_human;GENOMICS_ENGLAND;ORPHANET;UNIPROT |
Tgene | RET | C3888239 | HIRSCHSPRUNG DISEASE, SUSCEPTIBILITY TO, 1 | 16 | GENOMICS_ENGLAND;UNIPROT |
Tgene | RET | C0025268 | Multiple Endocrine Neoplasia Type 2a | 15 | CTD_human;GENOMICS_ENGLAND;ORPHANET;UNIPROT |
Tgene | RET | C1708353 | Hereditary Paraganglioma-Pheochromocytoma Syndrome | 12 | CLINGEN |
Tgene | RET | C0025269 | Multiple Endocrine Neoplasia Type 2b | 10 | CTD_human;GENOMICS_ENGLAND;ORPHANET;UNIPROT |
Tgene | RET | C0238463 | Papillary thyroid carcinoma | 3 | CTD_human;ORPHANET |
Tgene | RET | C1275808 | Congenital central hypoventilation | 3 | CTD_human;GENOMICS_ENGLAND;UNIPROT |
Tgene | RET | C1859049 | CCHS WITH HIRSCHSPRUNG DISEASE | 3 | CTD_human;ORPHANET |
Tgene | RET | C0009402 | Colorectal Carcinoma | 2 | CTD_human;UNIPROT |
Tgene | RET | C0009404 | Colorectal Neoplasms | 2 | CTD_human |
Tgene | RET | C0019569 | Hirschsprung Disease | 2 | CTD_human |
Tgene | RET | C0027662 | Multiple Endocrine Neoplasia | 2 | CTD_human;GENOMICS_ENGLAND |
Tgene | RET | C0085758 | Aganglionosis, Colonic | 2 | CTD_human |
Tgene | RET | C0266294 | Unilateral agenesis of kidney | 2 | ORPHANET |
Tgene | RET | C1257840 | Aganglionosis, Rectosigmoid Colon | 2 | CTD_human |
Tgene | RET | C3661523 | Congenital Intestinal Aganglionosis | 2 | CTD_human |
Top |
Clinical Trials of the Found Drugs/Small Molecules |
Statistics of the Clinical Trials of the Found Kinase Inibitors from clinicaltrials.gov (06-17-2024) |
Clinical Trials from clinicaltrials.gov (06-17-2024) |
Fusion Gene | Kinase Inhibitor | NCT ID | Study Status | Phases | Disease | # Enrolment | Date |