| UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
|
|||||||
|
Kinase Fusion Gene:SPTBN4_JAK3 |
Kinase Fusion Protein Summary |
 Kinase Fusion gene summary |
| Kinase Fusion partner gene information | Kinase Fusion gene name: SPTBN4_JAK3 | KinaseFusionDB ID: KFG6030 | FusionGDB2.0 ID: KFG6030 | Hgene | Tgene | Gene symbol | SPTBN4 | JAK3 | Gene ID | 57731 | 3718 | |
| Gene name | spectrin beta, non-erythrocytic 4 | Janus kinase 3 | ||||||||||
| Synonyms | CMND|NEDHND|QV|SPNB4|SPTBN3 | JAK-3|JAK3_HUMAN|JAKL|L-JAK|LJAK | ||||||||||
| Cytomap | 19q13.2 | 19p13.11 | ||||||||||
| Type of gene | protein-coding | protein-coding | ||||||||||
| Description | spectrin beta chain, non-erythrocytic 4beta-IV spectrinspectrin beta chain, brain 3spectrin, non-erythroid beta chain 3 | tyrosine-protein kinase JAK3Janus kinase 3 (a protein tyrosine kinase, leukocyte)leukocyte Janus kinase | ||||||||||
| Modification date | 20240403 | 20240411 | ||||||||||
| UniProtAcc | Q9H254 | P52333 | ||||||||||
| Ensembl transtripts involved in fusion gene | ENST ids | ENST00000595535, ENST00000352632, ENST00000344104, ENST00000338932, ENST00000598249, ENST00000392025, ENST00000392023, ENST00000593816, | ENST00000458235, ENST00000534444, ENST00000526008, ENST00000527670, | |||||||||
| Context (manual curation of fusion genes in KinaseFusionDB) | PubMed: SPTBN4 [Title/Abstract] AND JAK3 [Title/Abstract] AND fusion [Title/Abstract] | |||||||||||
| Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) | ||||||||||||
| Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Partner | Gene | GO ID | GO term | PubMed ID |
| Tgene | JAK3 | GO:0035723 | interleukin-15-mediated signaling pathway | 7568001 |
| Tgene | JAK3 | GO:0035771 | interleukin-4-mediated signaling pathway | 7538655 |
| Tgene | JAK3 | GO:0038110 | interleukin-2-mediated signaling pathway | 7973659 |
| Tgene | JAK3 | GO:0038113 | interleukin-9-mediated signaling pathway | 18829468 |
| Tgene | JAK3 | GO:0070670 | response to interleukin-4 | 7538655|7594533 |
| Kinase Fusion gene breakpoints across SPTBN4 (5'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
| Kinase Fusion gene breakpoints across JAK3 (3'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Top |
Kinase Fusion Gene Sample Information |
| Kinase Fusion gene information. |
| Kinase Fusion gene information from four resources (ChiTars 5.0, ChimerDB 4.0, COSMIC, and CCLE) * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
| Source | Sample | Hgene | Hchr | Hbp | Tgene | Tchr | Tbp |
| CCLE | LN-319 | SPTBN4 | chr19 | 41012293 | JAK3 | chr19 | 17946024 |
| CCLE | LN-319 | SPTBN4 | chr19 | 41012293 | JAK3 | chr19 | 17942607 |
| CCLE | LN-319 | SPTBN4 | chr19 | 41012293 | JAK3 | chr19 | 17943738 |
Top |
Kinase Fusion ORF Analysis |
| Kinase Fusion information from ORFfinder translation from full-length transcript sequence from KinaseFusionDB. |
| Henst | Tenst | Hgene | Hchr | Hbp | Tgene | Tchr | Tbp | Seq length (transcript) | Seq length (amino acids) |
| ENST00000595535 | ENST00000458235 | SPTBN4 | chr19 | 41012293 | JAK3 | chr19 | 17943738 | 4884 | 946 |
Top |
Kinase Fusion Amino Acid Sequences |
| For individual full-length fusion transcript sequence from KinaseFusionDB, we ran ORFfinder and chose the longest ORF among the all predicted ones. |
| >Henst_Tenst_Hgene_Hchr_Hbp_Tgene_Tchr_Tbp_length(fusion AA)_AAseq >ENST00000595535_ENST00000458235_SPTBN4_chr19_41012293_JAK3_chr19_17943738_length(amino acids)=946 MAQVPGEVDNMEGLPAPNNNPAARWESPDRGWEREQPAASTAAASLFECSRIKALADEREAVQKKTFTKWVNSHLARVGCHIGDLYVDLR DGFVLTRLLEVLSGEQLPRPTRGRMRIHSLENVDKALQFLKEQRVHLENVGSHDIVDGNHRLTLGLVWTIILRFQIQVIKIETEDNRETR SAKDALLLWCQMKTAGYPEVNIQNFTTSWRDGLAFNALIHRHRPDLVDFSKLTKSNANYNLQRAFRTAEQHLGLARLLDPEDVNMEAPDE KSIITYVVSFYHYFSKMKALAVEGKRIGKVLDQVLEVGKIIERYEELAAELLAWIHRTVGLISNQKFANSLSGVQQQLQAFTAYCTLEKP VKFQEKGNLEVLLFSIQSKLRACNRRLFVPREGCGIWDIDKAWGELEKAEHEREAALRAELIRQEKLELLAQRFDHKVAMRESWLNENQR LVSQDNFGYELPAVEAAMKKHEAIEADIAAYEERVQGVAELAQALAAEGYYDIRRVAAQRDSVLRQWALLTGLVGARRTRLEQNLALQKV FQEMVYMVDWMEEMQAQLLSRECGQHLVEADDLLQKHGLLEGDIAAQSERVEALNAAALRFSQLQDYELLSDPTPGALAPRDGLWNGAQL YACQDPTIFEERHLKYISQLGKGNFGSVELCRYDPLGDNTGALVAVKQLQHSGPDQQRDFQREIQILKALHSDFIVKYRGVSYGPGRQSL RLVMEYLPSGCLRDFLQRHRARLDASRLLLYSSQICKGMEYLGSRRCVHRDLAARNILVESEAHVKIADFGLAKLLPLDKDYYVVREPGQ SPIFWYAPESLSDNIFSRQSDVWSFGVVLYELFTYCDKSCSPSAEFLRMMGCERDVPALCRLLELLEEGQRLPAPPACPAEVHELMKLCW -------------------------------------------------------------- |
Multiple Sequence Alignment of All Fusion Protein Isoforms |
Top |
Kinase Fusion Protein Functional Features |
| Four levels of functional features of fusion genes Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr19:/chr19:) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
 |
| Main function of each fusion partner protein. (from UniProt) |
| Hgene | Tgene |
| SPTBN4 | JAK3 |
| FUNCTION: Non-receptor tyrosine kinase involved in various processes such as cell growth, development, or differentiation. Mediates essential signaling events in both innate and adaptive immunity and plays a crucial role in hematopoiesis during T-cells development. In the cytoplasm, plays a pivotal role in signal transduction via its association with type I receptors sharing the common subunit gamma such as IL2R, IL4R, IL7R, IL9R, IL15R and IL21R. Following ligand binding to cell surface receptors, phosphorylates specific tyrosine residues on the cytoplasmic tails of the receptor, creating docking sites for STATs proteins. Subsequently, phosphorylates the STATs proteins once they are recruited to the receptor. Phosphorylated STATs then form homodimer or heterodimers and translocate to the nucleus to activate gene transcription. For example, upon IL2R activation by IL2, JAK1 and JAK3 molecules bind to IL2R beta (IL2RB) and gamma chain (IL2RG) subunits inducing the tyrosine phosphorylation of both receptor subunits on their cytoplasmic domain. Then, STAT5A and STAT5B are recruited, phosphorylated and activated by JAK1 and JAK3. Once activated, dimerized STAT5 translocates to the nucleus and promotes the transcription of specific target genes in a cytokine-specific fashion. {ECO:0000269|PubMed:11909529, ECO:0000269|PubMed:20440074, ECO:0000269|PubMed:7662955, ECO:0000269|PubMed:8022485}. |
| Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
| - Retained domain in the 5'-partner of fusion protein (protein functional feature from UniProt). |
| Partner | Hgeneene | Hbp | Tgeneene | Tbp | ENST | BPexon | TotalExon | Protein feature loci | BPloci | TotalLen | Feature | Note |
| - Retained domain in the 3'-partner of fusion protein (protein functional feature from UniProt). |
| Partner | Hgeneene | Hbp | Tgeneene | Tbp | ENST | BPexon | TotalExon | Protein feature loci | BPloci | TotalLen | Feature | Note |
| Tgene | SPTBN4 | 41012293 | JAK3 | 17943738 | ENST00000595535 | 15 | 23 | 822_1111 | 783 | 1125 | Domain | Note=Protein kinase 2;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00159 |
| Tgene | SPTBN4 | 41012293 | JAK3 | 17943738 | ENST00000595535 | 16 | 23 | 822_1111 | 783 | 1095 | Domain | Note=Protein kinase 2;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00159 |
| Tgene | SPTBN4 | 41012293 | JAK3 | 17943738 | ENST00000595535 | 16 | 24 | 822_1111 | 783 | 1125 | Domain | Note=Protein kinase 2;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00159 |
Top |
Kinase Fusion Protein Structures |
| CIF files of the predicted kinase fusion proteins * Here we show the 3D structure of the fusion proteins using Mol*. AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Model confidence is shown from the pLDDT values per residue. pLDDT corresponds to the model’s prediction of its score on the local Distance Difference Test. It is a measure of local accuracy (from AlphfaFold website). To color code individual residues, we transformed individual PDB files into CIF format. |
| Kinase Fusion protein CIF link (fusion AA seq ID in KinaseFusionDB) | Henst | Tenst | Hgene | Hchr | Hbp | Tgene | Tchr | Tbp | AA seq | Len(AA seq) |
| PDB file >>>470_SPTBN4_JAK3 | ENST00000595535 | ENST00000458235 | SPTBN4 | chr19 | 41012293 | JAK3 | chr19 | 17943738 | MAQVPGEVDNMEGLPAPNNNPAARWESPDRGWEREQPAASTAAASLFECSRIKALADEREAVQKKTFTKWVNSHLARVGCHIGDLYVDLR DGFVLTRLLEVLSGEQLPRPTRGRMRIHSLENVDKALQFLKEQRVHLENVGSHDIVDGNHRLTLGLVWTIILRFQIQVIKIETEDNRETR SAKDALLLWCQMKTAGYPEVNIQNFTTSWRDGLAFNALIHRHRPDLVDFSKLTKSNANYNLQRAFRTAEQHLGLARLLDPEDVNMEAPDE KSIITYVVSFYHYFSKMKALAVEGKRIGKVLDQVLEVGKIIERYEELAAELLAWIHRTVGLISNQKFANSLSGVQQQLQAFTAYCTLEKP VKFQEKGNLEVLLFSIQSKLRACNRRLFVPREGCGIWDIDKAWGELEKAEHEREAALRAELIRQEKLELLAQRFDHKVAMRESWLNENQR LVSQDNFGYELPAVEAAMKKHEAIEADIAAYEERVQGVAELAQALAAEGYYDIRRVAAQRDSVLRQWALLTGLVGARRTRLEQNLALQKV FQEMVYMVDWMEEMQAQLLSRECGQHLVEADDLLQKHGLLEGDIAAQSERVEALNAAALRFSQLQDYELLSDPTPGALAPRDGLWNGAQL YACQDPTIFEERHLKYISQLGKGNFGSVELCRYDPLGDNTGALVAVKQLQHSGPDQQRDFQREIQILKALHSDFIVKYRGVSYGPGRQSL RLVMEYLPSGCLRDFLQRHRARLDASRLLLYSSQICKGMEYLGSRRCVHRDLAARNILVESEAHVKIADFGLAKLLPLDKDYYVVREPGQ SPIFWYAPESLSDNIFSRQSDVWSFGVVLYELFTYCDKSCSPSAEFLRMMGCERDVPALCRLLELLEEGQRLPAPPACPAEVHELMKLCW | 946 |
| 3D view using mol* of 470_SPTBN4_JAK3 | ||||||||||
| PDB file >>>TKFP_797_SPTBN4_JAK3 | ENST00000595535 | ENST00000458235 | SPTBN4 | chr19 | 41012293 | JAK3 | chr19 | 17943738 | MAQVPGEVDNMEGLPAPNNNPAARWESPDRGWEREQPAASTAAASLFECSRIKALADEREAVQKKTFTKWVNSHLARVGCHIGDLYVDLR DGFVLTRLLEVLSGEQLPRPTRGRMRIHSLENVDKALQFLKEQRVHLENVGSHDIVDGNHRLTLGLVWTIILRFQIQVIKIETEDNRETR SAKDALLLWCQMKTAGYPEVNIQNFTTSWRDGLAFNALIHRHRPDLVDFSKLTKSNANYNLQRAFRTAEQHLGLARLLDPEDVNMEAPDE KSIITYVVSFYHYFSKMKALAVEGKRIGKVLDQVLEVGKIIERYEELAAELLAWIHRTVGLISNQKFANSLSGVQQQLQAFTAYCTLEKP VKFQEKGNLEVLLFSIQSKLRACNRRLFVPREGCGIWDIDKAWGELEKAEHEREAALRAELIRQEKLELLAQRFDHKVAMRESWLNENQR LVSQDNFGYELPAVEAAMKKHEAIEADIAAYEERVQGVAELAQALAAEGYYDIRRVAAQRDSVLRQWALLTGLVGARRTRLEQNLALQKV FQEMVYMVDWMEEMQAQLLSRECGQHLVEADDLLQKHGLLEGDIAAQSERVEALNAAALRFSQLQDYELLSDPTPGALAPRDGLWNGAQL YACQDPTIFEERHLKYISQLGKGNFGSVELCRYDPLGDNTGALVAVKQLQHSGPDQQRDFQREIQILKALHSDFIVKYRGVSYGPGRQSL RLVMEYLPSGCLRDFLQRHRARLDASRLLLYSSQICKGMEYLGSRRCVHRDLAARNILVESEAHVKIADFGLAKLLPLDKDYYVVREPGQ SPIFWYAPESLSDNIFSRQSDVWSFGVVLYELFTYCDKSCSPSAEFLRMMGCERDVPALCRLLELLEEGQRLPAPPACPAEVHELMKLCW | 946_SPTBN4_JAK3 |
Top |
Comparison of Fusion Protein Isoforms |
| Superimpose the 3D Structures Among All Fusion Protein Isoforms * Download the pdb file and open it from the molstar online viewer. |
| Comparison of the Secondary Structures of Fusion Protein Isoforms |
Top |
Comparison of Fusion Protein Sequences/Structures with Known Sequences/Structures from PDB |
Top |
pLDDT score distribution |
| pLDDT score distribution of the predicted fusion protein structures from AlphaFold2 * AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. * The blue color at the bottom marks the best active site residues. |
| 470_SPTBN4_JAK3.png |
 |
| 470_SPTBN4_JAK3.png |
 |
Top |
Potential Active Site Information |
| The potential binding sites of these fusion proteins were identified using SiteMap, a module of the Schrodinger suite. |
| Kinase Fusion AA seq ID in KinaseFusionDB | Site score | Size | Dscore | Volume | Exposure | Enclosure | Contact | Phobic | Philic | Balance | Don/Acc | Residues |
Top |
Ramachandran Plot of Kinase Fusion Protein Structure |
| Ramachandran plot of the torsional angles - phi (φ)and psi (ψ) - of the residues (amino acids) contained in this fusion protein peptide. |
| 470_SPTBN4_JAK3_ramachandran.png |
 |
Top |
Virtual Screening Results |
| Distribution of the average docking score across all approved kinase inhibitors. Distribution of the number of occurrence across all approved kinase inhibitors. |
| 5'-kinase fusion protein case |
| 3'-kinase fusion protein case |
Top |
| Drug information from DrugBank of the top 20 interacting small molecules. * The detailed information of individual kinase inhibitors are available in the download page. |
| Fusion gene name info | Drug | Docking score | Glide g score | Glide energy |
Top |
Kinase-Substrate Information of SPTBN4_JAK3 |
| Phosphorylation target of the kinase (phosphosite, 03-17-2024) |
| Kinase | Kinase UniProt Acc | Kinase species | Substrate | Substrate UniProt Acc | Substrate phosphorylated residues | Substrate phosphorylated sites (+/-7AA) | Domain |
| JAK3 | P52333 | human | STAT5A | P42229 | Y694 | LAkAVDGyVkPQIkQ | |
| JAK3 | P52333 | human | JAK1 | P23458 | Y1034 | AIEtDkEyytVkDDR | PK_Tyr_Ser-Thr |
| JAK3 | P52333 | human | CTNNB1 | P35222 | Y86 | VADIDGQyAMTRAQR | |
| JAK3 | P52333 | human | CTNNB1 | P35222 | Y30 | sHWQQQsyLDsGIHs | |
| JAK3 | P52333 | human | SIGLEC10 | Q96LC7 | Y597 | RHstILDyINVVPTA | |
| JAK3 | P52333 | human | CTNNB1 | P35222 | Y64 | VDTsQVLyEWEQGFS | |
| JAK3 | P52333 | human | ELAVL1 | Q15717 | Y68 | LGyGFVNyVTAkDAE | RRM_1 |
| JAK3 | P52333 | human | JAK3 | P52333 | Y980 | LLPLDkDyyVVREPG | PK_Tyr_Ser-Thr |
| JAK3 | P52333 | human | ELAVL1 | Q15717 | Y200 | VALLsQLyHsPArrF | |
| JAK3 | P52333 | human | JAK3 | P52333 | Y939 | QICkGMEyLGSRRCV | PK_Tyr_Ser-Thr |
| JAK3 | P52333 | human | PLD2 | O14939 | Y415 | ALGINSGysKRALML | |
| JAK3 | P52333 | human | EZH2 | Q15910 | Y244 | AEELKEKyKELTEQQ | PRC2_HTH_1 |
| JAK3 | P52333 | human | NFATC1 | O95644 | Y371 | ADFAPEDySSFQHIR | |
| JAK3 | P52333 | human | JAK3 | P52333 | Y785 | NSLIsSDyELLSDPT | |
| JAK3 | P52333 | human | JAK3 | P52333 | Y904 | SLRLVMEyLPSGCLR | PK_Tyr_Ser-Thr |
| JAK3 | P52333 | human | SIGLEC10 | Q96LC7 | Y667 | ESQEELHyATLNFPG | |
| JAK3 | P52333 | human | SHC1 | P29353-2 | Y410 | STTTPGQyVLTGLQS | SH2 |
| JAK3 | P52333 | human | SHC1 | P29353-2 | Y448 | SVSHLISyHMDNHLP | SH2 |
| JAK3 | P52333 | human | ELAVL1 | Q15717 | Y63 | VAGHSLGyGFVNyVT | RRM_1 |
| JAK3 | P52333 | human | JAK1 | P23458 | Y1035 | IEtDkEyytVkDDRD | PK_Tyr_Ser-Thr |
| JAK3 | P52333 | human | JAK3 | P52333 | Y981 | LPLDkDyyVVREPGQ | PK_Tyr_Ser-Thr |
| JAK3 | P52333 | human | SIGLEC10 | Q96LC7 | Y691 | PKGTQADyAEVKFQ_ | |
| JAK3 | P52333 | human | STAT1 | P42224 | Y701 | DGPkGtGyIktELIs |
| Biological Network Integration of This Kinase and Substrates (GeneMANIA website) |
| Enriched GO biological processes of the phosphorylation target genes of the kinase |
| Kinase | GOID | GO term | P.adjust |
| JAK3 | ID | Description | 0.00e+00 |
| JAK3 | GO:0035771 | interleukin-4-mediated signaling pathway | 4.30e-06 |
| JAK3 | GO:0060397 | growth hormone receptor signaling pathway via JAK-STAT | 4.30e-06 |
| JAK3 | GO:0035723 | interleukin-15-mediated signaling pathway | 4.30e-06 |
| JAK3 | GO:0070669 | response to interleukin-2 | 4.30e-06 |
| JAK3 | GO:0071350 | cellular response to interleukin-15 | 4.30e-06 |
| JAK3 | GO:0070672 | response to interleukin-15 | 4.78e-06 |
| JAK3 | GO:0060396 | growth hormone receptor signaling pathway | 4.22e-05 |
| JAK3 | GO:0071378 | cellular response to growth hormone stimulus | 4.22e-05 |
| JAK3 | GO:0071375 | cellular response to peptide hormone stimulus | 4.87e-05 |
| JAK3 | GO:0071353 | cellular response to interleukin-4 | 7.74e-05 |
| JAK3 | GO:0070670 | response to interleukin-4 | 8.40e-05 |
| JAK3 | GO:0060416 | response to growth hormone | 8.51e-05 |
| JAK3 | GO:1901653 | cellular response to peptide | 8.51e-05 |
| JAK3 | GO:0007259 | receptor signaling pathway via JAK-STAT | 1.39e-04 |
| JAK3 | GO:0043434 | response to peptide hormone | 1.46e-04 |
| JAK3 | GO:0097696 | receptor signaling pathway via STAT | 1.65e-04 |
| JAK3 | GO:0030857 | negative regulation of epithelial cell differentiation | 2.10e-04 |
| JAK3 | GO:1903131 | mononuclear cell differentiation | 2.11e-04 |
| JAK3 | GO:0003337 | mesenchymal to epithelial transition involved in metanephros morphogenesis | 7.91e-04 |
| JAK3 | GO:0072182 | regulation of nephron tubule epithelial cell differentiation | 9.01e-04 |
| JAK3 | GO:0072160 | nephron tubule epithelial cell differentiation | 1.13e-03 |
| JAK3 | GO:0072283 | metanephric renal vesicle morphogenesis | 1.13e-03 |
| JAK3 | GO:2000696 | regulation of epithelial cell differentiation involved in kidney development | 1.42e-03 |
| JAK3 | GO:0072077 | renal vesicle morphogenesis | 1.55e-03 |
| JAK3 | GO:0072087 | renal vesicle development | 1.67e-03 |
| JAK3 | GO:0060231 | mesenchymal to epithelial transition | 1.79e-03 |
| JAK3 | GO:0030098 | lymphocyte differentiation | 2.46e-03 |
| JAK3 | GO:0072202 | cell differentiation involved in metanephros development | 2.46e-03 |
| JAK3 | GO:0072273 | metanephric nephron morphogenesis | 2.59e-03 |
| JAK3 | GO:0002053 | positive regulation of mesenchymal cell proliferation | 2.72e-03 |
| JAK3 | GO:0060333 | type II interferon-mediated signaling pathway | 2.85e-03 |
| JAK3 | GO:0030856 | regulation of epithelial cell differentiation | 3.17e-03 |
| JAK3 | GO:0003338 | metanephros morphogenesis | 3.83e-03 |
| JAK3 | GO:0098727 | maintenance of cell number | 3.85e-03 |
| JAK3 | GO:0010464 | regulation of mesenchymal cell proliferation | 3.85e-03 |
| JAK3 | GO:0090183 | regulation of kidney development | 4.23e-03 |
| JAK3 | GO:0046677 | response to antibiotic | 4.88e-03 |
| JAK3 | GO:0072210 | metanephric nephron development | 5.84e-03 |
| JAK3 | GO:0010463 | mesenchymal cell proliferation | 6.56e-03 |
| JAK3 | GO:0035850 | epithelial cell differentiation involved in kidney development | 7.30e-03 |
| JAK3 | GO:0048762 | mesenchymal cell differentiation | 8.70e-03 |
| JAK3 | GO:0010559 | regulation of glycoprotein biosynthetic process | 9.31e-03 |
| JAK3 | GO:0014888 | striated muscle adaptation | 9.31e-03 |
| JAK3 | GO:0061005 | cell differentiation involved in kidney development | 9.77e-03 |
| JAK3 | GO:0010718 | positive regulation of epithelial to mesenchymal transition | 1.02e-02 |
| JAK3 | GO:1903018 | regulation of glycoprotein metabolic process | 1.07e-02 |
| JAK3 | GO:0030217 | T cell differentiation | 1.21e-02 |
| JAK3 | GO:0001822 | kidney development | 1.26e-02 |
| JAK3 | GO:0048872 | homeostasis of number of cells | 1.26e-02 |
Top |
Related Drugs to SPTBN4_JAK3 |
| Drugs used for this fusion-positive patient. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
| Hgene | Tgene | Drug | Source | PMID |
| Distribution of the number of studies mentioning SPTBN4-JAK3 and kinase inhibitors the PubMed Abstract (04-01-2024) |
| Fusion gene - drug pair 1 | Fusion gene - drug pair 2 | PMID | Publication date | DOI | Study title |
Top |
Related Diseases to SPTBN4_JAK3 |
| Diseases that have this fusion gene. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
| Hgene | Tgene | Disease | Source | PMID |
| Related diseases from the literature mentioned this fusion gene and drug. (PubMed, 04-01-2024) |
| MeSH ID | MeSH term |
| Diseases associated with fusion partners. (DisGeNet 4.0) |
| Partner | Gene | Disease ID | Disease name | # pubmeds | Source |
Top |
Clinical Trials of the Found Drugs/Small Molecules |
| Statistics of the Clinical Trials of the Found Kinase Inibitors from clinicaltrials.gov (06-17-2024) |
| Clinical Trials from clinicaltrials.gov (06-17-2024) |
| Fusion Gene | Kinase Inhibitor | NCT ID | Study Status | Phases | Disease | # Enrolment | Date |
Copyright 2024-Present -The University of Texas Health Science Center at Houston
Web File Viewing | Emergency Information |Campus Carry|Site Policies |