| UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
|
|||||||
|
Kinase Fusion Gene:BCR_RALGPS1 |
Kinase Fusion Protein Summary |
Kinase Fusion gene summary |
| Kinase Fusion partner gene information | Kinase Fusion gene name: BCR_RALGPS1 | KinaseFusionDB ID: KFG604 | FusionGDB2.0 ID: KFG604 | Hgene | Tgene | Gene symbol | BCR | RALGPS1 | Gene ID | 613 | 9649 | |
| Gene name | BCR activator of RhoGEF and GTPase | Ral GEF with PH domain and SH3 binding motif 1 | ||||||||||
| Synonyms | ALL|BCR1|CML|D22S11|D22S662|PHL | RALGEF2|RALGPS1A | ||||||||||
| Cytomap | 22q11.23 | 9q33.3 | ||||||||||
| Type of gene | protein-coding | protein-coding | ||||||||||
| Description | breakpoint cluster region proteinBCR, RhoGEF and GTPase activating proteinBCR/FGFR1 chimera proteinFGFR1/BCR chimera proteinbreakpoint cluster regionrenal carcinoma antigen NY-REN-26 | ras-specific guanine nucleotide-releasing factor RalGPS1Ral guanine nucleotide exchange factor RalGPS1Aral guanine nucleotide exchange factor 2ralA exchange factor RalGPS1 | ||||||||||
| Modification date | 20240416 | 20240411 | ||||||||||
| UniProtAcc | P11274 | Q5JS13 | ||||||||||
| Ensembl transtripts involved in fusion gene | ENST ids | ENST00000305877, ENST00000359540, ENST00000398512, ENST00000436990, | ENST00000394011, ENST00000480993, ENST00000259351, ENST00000373434, ENST00000373436, ENST00000394022, ENST00000424082, | |||||||||
| Context (manual curation of fusion genes in KinaseFusionDB) | PubMed: BCR [Title/Abstract] AND RALGPS1 [Title/Abstract] AND fusion [Title/Abstract] | |||||||||||
| Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) | BCR(23615961)-RALGPS1(129831507), # samples:2 | |||||||||||
Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Partner | Gene | GO ID | GO term | PubMed ID |
| Hgene | BCR | GO:0090630 | activation of GTPase activity | 7479768 |
| Tgene | RALGPS1 | GO:0032485 | regulation of Ral protein signal transduction | 10747847 |
Kinase Fusion gene breakpoints across BCR (5'-gene)* Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Kinase Fusion gene breakpoints across RALGPS1 (3'-gene)* Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Top |
Kinase Fusion Gene Sample Information |
Kinase Fusion gene information. |
Kinase Fusion gene information from four resources (ChiTars 5.0, ChimerDB 4.0, COSMIC, and CCLE)* All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
| Source | Sample | Hgene | Hchr | Hbp | Tgene | Tchr | Tbp |
| ChimerDB4 | HQ622706 | BCR | chr22 | 23615961 | RALGPS1 | chr9 | 129831507 |
| ChiTaRS5.0 | HQ622706 | BCR | chr22 | 23615961 | RALGPS1 | chr9 | 129831507 |
Top |
Kinase Fusion ORF Analysis |
Kinase Fusion information from ORFfinder translation from full-length transcript sequence from KinaseFusionDB. |
| Henst | Tenst | Hgene | Hchr | Hbp | Tgene | Tchr | Tbp | Seq length (transcript) | Seq length (amino acids) |
| ENST00000305877 | ENST00000424082 | BCR | chr22 | 23615961 | RALGPS1 | chr9 | 129831507 | 4441 | 1081 |
Top |
Kinase Fusion Amino Acid Sequences |
For individual full-length fusion transcript sequence from KinaseFusionDB, we ran ORFfinder and chose the longest ORF among the all predicted ones. |
| >Henst_Tenst_Hgene_Hchr_Hbp_Tgene_Tchr_Tbp_length(fusion AA)_AAseq >ENST00000305877_ENST00000424082_BCR_chr22_23615961_RALGPS1_chr9_129831507_length(amino acids)=1081 MVDPVGFAEAWKAQFPDSEPPRMELRSVGDIEQELERCKASIRRLEQEVNQERFRMIYLQTLLAKEKKSYDRQRWGFRRAAQAPDGASEP RASASRPQPAPADGADPPPAEEPEARPDGEGSPGKARPGTARRPGAAASGERDDRGPPASVAALRSNFERIRKGHGQPGADAEKPFYVNV EFHHERGLVKVNDKEVSDRISSLGSQAMQMERKKSQHGAGSSVGDASRPPYRGRSSESSCGVDGDYEDAELNPRFLKDNLIDANGGSRPP WPPLEYQPYQSIYVGGMMEGEGKGPLLRSQSTSEQEKRLTWPRRSYSPRSFEDCGGGYTPDCSSNENLTSSEEDFSSGQSSRVSPSPTTY RMFRDKSRSPSQNSQQSFDSSSPPTPQCHKRHRHCPVVVSEATIVGVRKTGQIWPNDGEGAFHGDADGSFGTPPGYGCAADRAEEQRRHQ DGLPYIDDSPSSSPHLSSKGRGSRDALVSGALESTKASELDLEKGLEMRKWVLSGILASEETYLSHLEALLLPMKPLKAAATTSQPVLTS QQIETIFFKVPELYEIHKEFYDGLFPRVQQWSHQQRVGDLFQKLASQLGVYRAFVDNYGVAMEMAEKCCQANAQFAEISENLRARSNKDA KDPTTKNSLETLLYKPVDRVTRSTLVLHDLLKHTPASHPDHPLLQDALRISQNFLSSINEEITPRRQSMTVKKGELLNRKDKTTFEKLDY LMSKEDNYKRTREYIRSLKMVPSIPYLGIYLLDLIYIDSAYPASGSIMENEQRSNQMNNILRIIADLQVSCSYDHLTTLPHVQKYLKSVR YIEELQKFVEDDNYKLSLRIEPGSSSPRLVSSKEDLAGPSAGSGSARFSRRPTCPDTSVAGSLPTPPVPRHRKSHSLGNNRGRLYATLGP NWRVPVRNSPRTRSCVYSPTGPCICSLGNSAAVPTMEGPLRRKTLLKEGRKPALSSWTRYWVILSGSTLLYYGAKSLRGTDRKHYKSTPG KKVSIVGWMVQLPDDPEHPDIFQLNNPDKGNVYKFQTGSRFHAILWHKHLDDACKSNRPQEAGAAPGPTGTDSHEVDHLEGGAGKEAGPC -------------------------------------------------------------- |
Multiple Sequence Alignment of All Fusion Protein Isoforms |
Top |
Kinase Fusion Protein Functional Features |
Four levels of functional features of fusion genesGo to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr22:23615961/chr9:129831507) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
![]() |
Main function of each fusion partner protein. (from UniProt) |
| Hgene | Tgene |
| BCR | RALGPS1 |
| FUNCTION: Protein with a unique structure having two opposing regulatory activities toward small GTP-binding proteins. The C-terminus is a GTPase-activating protein (GAP) domain which stimulates GTP hydrolysis by RAC1, RAC2 and CDC42. Accelerates the intrinsic rate of GTP hydrolysis of RAC1 or CDC42, leading to down-regulation of the active GTP-bound form (PubMed:7479768, PubMed:1903516, PubMed:17116687). The central Dbl homology (DH) domain functions as guanine nucleotide exchange factor (GEF) that modulates the GTPases CDC42, RHOA and RAC1. Promotes the conversion of CDC42, RHOA and RAC1 from the GDP-bound to the GTP-bound form (PubMed:7479768, PubMed:23940119). The amino terminus contains an intrinsic kinase activity (PubMed:1657398). Functions as an important negative regulator of neuronal RAC1 activity (By similarity). Regulates macrophage functions such as CSF1-directed motility and phagocytosis through the modulation of RAC1 activity (PubMed:17116687). Plays a major role as a RHOA GEF in keratinocytes being involved in focal adhesion formation and keratinocyte differentiation (PubMed:23940119). {ECO:0000250|UniProtKB:Q6PAJ1, ECO:0000269|PubMed:1657398, ECO:0000269|PubMed:17116687, ECO:0000269|PubMed:1903516, ECO:0000269|PubMed:23940119, ECO:0000269|PubMed:7479768}. | FUNCTION: Guanine nucleotide exchange factor (GEF) for the small GTPase RALA. May be involved in cytoskeletal organization (By similarity). Guanine nucleotide exchange factor for. {ECO:0000250, ECO:0000269|PubMed:10747847, ECO:0000269|PubMed:10889189}. |
Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
- Retained domain in the 5'-partner of fusion protein (protein functional feature from UniProt). |
| Partner | Hgeneene | Hbp | Tgeneene | Tbp | ENST | BPexon | TotalExon | Protein feature loci | BPloci | TotalLen | Feature | Note |
| Hgene | BCR | 23615961 | RALGPS1 | 129831507 | ENST00000305877 | 8 | 22 | 498_691 | 7051 | 1228 | Domain | Note=DH;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00062 |
| Hgene | BCR | 23615961 | RALGPS1 | 129831507 | ENST00000305877 | 8 | 23 | 498_691 | 7051 | 1272 | Domain | Note=DH;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00062 |
- Retained domain in the 3'-partner of fusion protein (protein functional feature from UniProt). |
| Partner | Hgeneene | Hbp | Tgeneene | Tbp | ENST | BPexon | TotalExon | Protein feature loci | BPloci | TotalLen | Feature | Note |
Top |
Kinase Fusion Protein Structures |
CIF files of the predicted kinase fusion proteins * Here we show the 3D structure of the fusion proteins using Mol*. AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Model confidence is shown from the pLDDT values per residue. pLDDT corresponds to the model’s prediction of its score on the local Distance Difference Test. It is a measure of local accuracy (from AlphfaFold website). To color code individual residues, we transformed individual PDB files into CIF format. |
| Kinase Fusion protein CIF link (fusion AA seq ID in KinaseFusionDB) | Henst | Tenst | Hgene | Hchr | Hbp | Tgene | Tchr | Tbp | AA seq | Len(AA seq) |
| PDB file >>>40_BCR_RALGPS1 | ENST00000305877 | ENST00000424082 | BCR | chr22 | 23615961 | RALGPS1 | chr9 | 129831507 | MVDPVGFAEAWKAQFPDSEPPRMELRSVGDIEQELERCKASIRRLEQEVNQERFRMIYLQTLLAKEKKSYDRQRWGFRRAAQAPDGASEP RASASRPQPAPADGADPPPAEEPEARPDGEGSPGKARPGTARRPGAAASGERDDRGPPASVAALRSNFERIRKGHGQPGADAEKPFYVNV EFHHERGLVKVNDKEVSDRISSLGSQAMQMERKKSQHGAGSSVGDASRPPYRGRSSESSCGVDGDYEDAELNPRFLKDNLIDANGGSRPP WPPLEYQPYQSIYVGGMMEGEGKGPLLRSQSTSEQEKRLTWPRRSYSPRSFEDCGGGYTPDCSSNENLTSSEEDFSSGQSSRVSPSPTTY RMFRDKSRSPSQNSQQSFDSSSPPTPQCHKRHRHCPVVVSEATIVGVRKTGQIWPNDGEGAFHGDADGSFGTPPGYGCAADRAEEQRRHQ DGLPYIDDSPSSSPHLSSKGRGSRDALVSGALESTKASELDLEKGLEMRKWVLSGILASEETYLSHLEALLLPMKPLKAAATTSQPVLTS QQIETIFFKVPELYEIHKEFYDGLFPRVQQWSHQQRVGDLFQKLASQLGVYRAFVDNYGVAMEMAEKCCQANAQFAEISENLRARSNKDA KDPTTKNSLETLLYKPVDRVTRSTLVLHDLLKHTPASHPDHPLLQDALRISQNFLSSINEEITPRRQSMTVKKGELLNRKDKTTFEKLDY LMSKEDNYKRTREYIRSLKMVPSIPYLGIYLLDLIYIDSAYPASGSIMENEQRSNQMNNILRIIADLQVSCSYDHLTTLPHVQKYLKSVR YIEELQKFVEDDNYKLSLRIEPGSSSPRLVSSKEDLAGPSAGSGSARFSRRPTCPDTSVAGSLPTPPVPRHRKSHSLGNNRGRLYATLGP NWRVPVRNSPRTRSCVYSPTGPCICSLGNSAAVPTMEGPLRRKTLLKEGRKPALSSWTRYWVILSGSTLLYYGAKSLRGTDRKHYKSTPG KKVSIVGWMVQLPDDPEHPDIFQLNNPDKGNVYKFQTGSRFHAILWHKHLDDACKSNRPQEAGAAPGPTGTDSHEVDHLEGGAGKEAGPC | 1081 |
| 3D view using mol* of 40_BCR_RALGPS1 | ||||||||||
| PDB file >>>HKFP_56_BCR_RALGPS1 | ENST00000305877 | ENST00000424082 | BCR | chr22 | 23615961 | RALGPS1 | chr9 | 129831507 | MVDPVGFAEAWKAQFPDSEPPRMELRSVGDIEQELERCKASIRRLEQEVNQERFRMIYLQTLLAKEKKSYDRQRWGFRRAAQAPDGASEP RASASRPQPAPADGADPPPAEEPEARPDGEGSPGKARPGTARRPGAAASGERDDRGPPASVAALRSNFERIRKGHGQPGADAEKPFYVNV EFHHERGLVKVNDKEVSDRISSLGSQAMQMERKKSQHGAGSSVGDASRPPYRGRSSESSCGVDGDYEDAELNPRFLKDNLIDANGGSRPP WPPLEYQPYQSIYVGGMMEGEGKGPLLRSQSTSEQEKRLTWPRRSYSPRSFEDCGGGYTPDCSSNENLTSSEEDFSSGQSSRVSPSPTTY RMFRDKSRSPSQNSQQSFDSSSPPTPQCHKRHRHCPVVVSEATIVGVRKTGQIWPNDGEGAFHGDADGSFGTPPGYGCAADRAEEQRRHQ DGLPYIDDSPSSSPHLSSKGRGSRDALVSGALESTKASELDLEKGLEMRKWVLSGILASEETYLSHLEALLLPMKPLKAAATTSQPVLTS QQIETIFFKVPELYEIHKEFYDGLFPRVQQWSHQQRVGDLFQKLASQLGVYRAFVDNYGVAMEMAEKCCQANAQFAEISENLRARSNKDA KDPTTKNSLETLLYKPVDRVTRSTLVLHDLLKHTPASHPDHPLLQDALRISQNFLSSINEEITPRRQSMTVKKGELLNRKDKTTFEKLDY LMSKEDNYKRTREYIRSLKMVPSIPYLGIYLLDLIYIDSAYPASGSIMENEQRSNQMNNILRIIADLQVSCSYDHLTTLPHVQKYLKSVR YIEELQKFVEDDNYKLSLRIEPGSSSPRLVSSKEDLAGPSAGSGSARFSRRPTCPDTSVAGSLPTPPVPRHRKSHSLGNNRGRLYATLGP NWRVPVRNSPRTRSCVYSPTGPCICSLGNSAAVPTMEGPLRRKTLLKEGRKPALSSWTRYWVILSGSTLLYYGAKSLRGTDRKHYKSTPG KKVSIVGWMVQLPDDPEHPDIFQLNNPDKGNVYKFQTGSRFHAILWHKHLDDACKSNRPQEAGAAPGPTGTDSHEVDHLEGGAGKEAGPC | 1081_BCR_RALGPS1 |
Top |
Comparison of Fusion Protein Isoforms |
Superimpose the 3D Structures Among All Fusion Protein Isoforms * Download the pdb file and open it from the molstar online viewer. |
Comparison of the Secondary Structures of Fusion Protein Isoforms |
Top |
Comparison of Fusion Protein Sequences/Structures with Known Sequences/Structures from PDB |
Top |
pLDDT score distribution |
pLDDT score distribution of the predicted fusion protein structures from AlphaFold2* AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. * The blue color at the bottom marks the best active site residues. |
| 40_BCR_RALGPS1.png |
![]() |
| 40_BCR_RALGPS1.png |
![]() |
Top |
Potential Active Site Information |
The potential binding sites of these fusion proteins were identified using SiteMap, a module of the Schrodinger suite. |
| Kinase Fusion AA seq ID in KinaseFusionDB | Site score | Size | Dscore | Volume | Exposure | Enclosure | Contact | Phobic | Philic | Balance | Don/Acc | Residues |
Top |
Ramachandran Plot of Kinase Fusion Protein Structure |
Ramachandran plot of the torsional angles - phi (φ)and psi (ψ) - of the residues (amino acids) contained in this fusion protein peptide. |
| 40_BCR_RALGPS1_ramachandran.png |
![]() |
Top |
Virtual Screening Results |
Distribution of the average docking score across all approved kinase inhibitors.Distribution of the number of occurrence across all approved kinase inhibitors. |
| 5'-kinase fusion protein case |
![]() |
| 3'-kinase fusion protein case |
Top |
Drug information from DrugBank of the top 20 interacting small molecules.* The detailed information of individual kinase inhibitors are available in the download page. |
| Fusion gene name info | Drug | Docking score | Glide g score | Glide energy |
| 40_BCR_RALGPS1-DOCK_HTVS_1-001 | Lapatinib | -5.56005 | -5.64885 | -55.5225 |
| 40_BCR_RALGPS1-DOCK_HTVS_1-001 | Baricitinib | -5.530880000000001 | -5.530880000000001 | -36.791 |
| 40_BCR_RALGPS1-DOCK_HTVS_1-001 | Tofacitinib | -5.31597 | -5.32747 | -30.1505 |
| 40_BCR_RALGPS1-DOCK_HTVS_1-001 | Tofacitinib | -5.31597 | -5.32747 | -30.1505 |
| 40_BCR_RALGPS1-DOCK_HTVS_1-001 | Tepotinib | -5.31525 | -5.31635 | -51.2093 |
| 40_BCR_RALGPS1-DOCK_HTVS_1-001 | Nilotinib | -5.2862800000000005 | -5.42588 | -52.6259 |
| 40_BCR_RALGPS1-DOCK_HTVS_1-001 | Nilotinib | -5.2862800000000005 | -5.42588 | -52.6259 |
| 40_BCR_RALGPS1-DOCK_HTVS_1-001 | Larotrectinib | -5.25595 | -5.25595 | -42.3365 |
| 40_BCR_RALGPS1-DOCK_HTVS_1-001 | Vandetanib | -5.12787 | -5.12787 | -46.7234 |
| 40_BCR_RALGPS1-DOCK_HTVS_1-001 | Larotrectinib | -5.10376 | -5.10376 | -37.2876 |
| 40_BCR_RALGPS1-DOCK_HTVS_1-001 | Entrectinib | -5.06013 | -5.12483 | -48.3014 |
| 40_BCR_RALGPS1-DOCK_HTVS_1-001 | Tofacitinib | -4.9644900000000005 | -4.97599 | -29.9828 |
| 40_BCR_RALGPS1-DOCK_HTVS_1-001 | Tofacitinib | -4.9644900000000005 | -4.97599 | -29.9828 |
| 40_BCR_RALGPS1-DOCK_HTVS_1-001 | Entrectinib | -4.8101400000000005 | -4.87484 | -47.0757 |
| 40_BCR_RALGPS1-DOCK_HTVS_1-001 | Entrectinib | -4.8101400000000005 | -4.87484 | -47.0757 |
| 40_BCR_RALGPS1-DOCK_HTVS_1-001 | Ruxolitinib | -4.74364 | -4.74364 | -35.0882 |
| 40_BCR_RALGPS1-DOCK_HTVS_1-001 | Selumetinib | -4.724469999999999 | -4.733169999999999 | -41.3834 |
| 40_BCR_RALGPS1-DOCK_HTVS_1-001 | Selumetinib | -4.724469999999999 | -4.733169999999999 | -41.3834 |
| 40_BCR_RALGPS1-DOCK_HTVS_1-001 | Pacritinib | -4.70977 | -4.7148699999999995 | -37.236999999999995 |
| 40_BCR_RALGPS1-DOCK_HTVS_1-001 | Binimetinib | -4.7066 | -4.7153 | -46.7032 |
Top |
Kinase-Substrate Information of BCR_RALGPS1 |
Phosphorylation target of the kinase(phosphosite, 03-17-2024) |
| Kinase | Kinase UniProt Acc | Kinase species | Substrate | Substrate UniProt Acc | Substrate phosphorylated residues | Substrate phosphorylated sites (+/-7AA) | Domain |
| BCR | P11274 | human | YWHAQ | P27348 | S232 | LTLWtsDsAGEECDA | |
| BCR | P11274 | human | YWHAZ | P63104 | T232 | LTLWtsDtQGDEAEA | |
| BCR | P11274 | human | AFDN | P55196 | T909 | VVTVAENtADELARS |
Biological Network Integration of This Kinase and Substrates (GeneMANIA website) |
Enriched GO biological processes of the phosphorylation target genes of the kinase |
| Kinase | GOID | GO term | P.adjust |
| BCR | ID | Description | 0.00e+00 |
| BCR | GO:0007265 | Ras protein signal transduction | 4.45e-04 |
| BCR | GO:2000404 | regulation of T cell migration | 8.95e-04 |
| BCR | GO:0007264 | small GTPase mediated signal transduction | 8.95e-04 |
| BCR | GO:0002685 | regulation of leukocyte migration | 1.08e-03 |
| BCR | GO:2000401 | regulation of lymphocyte migration | 1.11e-03 |
| BCR | GO:0072678 | T cell migration | 1.11e-03 |
| BCR | GO:0048041 | focal adhesion assembly | 1.50e-03 |
| BCR | GO:0007044 | cell-substrate junction assembly | 1.54e-03 |
| BCR | GO:0034446 | substrate adhesion-dependent cell spreading | 1.54e-03 |
| BCR | GO:0150115 | cell-substrate junction organization | 1.54e-03 |
| BCR | GO:0032956 | regulation of actin cytoskeleton organization | 1.54e-03 |
| BCR | GO:0110020 | regulation of actomyosin structure organization | 1.54e-03 |
| BCR | GO:1905244 | regulation of modification of synaptic structure | 1.54e-03 |
| BCR | GO:0031589 | cell-substrate adhesion | 1.74e-03 |
| BCR | GO:0003188 | heart valve formation | 1.81e-03 |
| BCR | GO:0032970 | regulation of actin filament-based process | 1.81e-03 |
| BCR | GO:0072676 | lymphocyte migration | 1.81e-03 |
| BCR | GO:0071675 | regulation of mononuclear cell migration | 1.81e-03 |
| BCR | GO:1902903 | regulation of supramolecular fiber organization | 1.81e-03 |
| BCR | GO:0050900 | leukocyte migration | 1.84e-03 |
| BCR | GO:0007266 | Rho protein signal transduction | 2.09e-03 |
| BCR | GO:2000377 | regulation of reactive oxygen species metabolic process | 2.47e-03 |
| BCR | GO:0034329 | cell junction assembly | 2.55e-03 |
| BCR | GO:0030010 | establishment of cell polarity | 2.70e-03 |
| BCR | GO:0006312 | mitotic recombination | 3.06e-03 |
| BCR | GO:0000724 | double-strand break repair via homologous recombination | 3.36e-03 |
| BCR | GO:1902905 | positive regulation of supramolecular fiber organization | 3.36e-03 |
| BCR | GO:0099563 | modification of synaptic structure | 3.36e-03 |
| BCR | GO:0000725 | recombinational repair | 3.36e-03 |
| BCR | GO:0051495 | positive regulation of cytoskeleton organization | 3.52e-03 |
| BCR | GO:0061138 | morphogenesis of a branching epithelium | 3.58e-03 |
| BCR | GO:0042770 | signal transduction in response to DNA damage | 3.58e-03 |
| BCR | GO:0033688 | regulation of osteoblast proliferation | 3.59e-03 |
| BCR | GO:0045907 | positive regulation of vasoconstriction | 3.71e-03 |
| BCR | GO:0001763 | morphogenesis of a branching structure | 3.90e-03 |
| BCR | GO:0050851 | antigen receptor-mediated signaling pathway | 3.90e-03 |
| BCR | GO:0071674 | mononuclear cell migration | 3.90e-03 |
| BCR | GO:2000406 | positive regulation of T cell migration | 3.90e-03 |
| BCR | GO:0031032 | actomyosin structure organization | 3.90e-03 |
| BCR | GO:0033687 | osteoblast proliferation | 4.01e-03 |
| BCR | GO:0006282 | regulation of DNA repair | 4.09e-03 |
| BCR | GO:0010810 | regulation of cell-substrate adhesion | 4.27e-03 |
| BCR | GO:0071222 | cellular response to lipopolysaccharide | 4.52e-03 |
| BCR | GO:0007163 | establishment or maintenance of cell polarity | 4.53e-03 |
| BCR | GO:0072593 | reactive oxygen species metabolic process | 4.65e-03 |
| BCR | GO:1900026 | positive regulation of substrate adhesion-dependent cell spreading | 4.65e-03 |
| BCR | GO:2000403 | positive regulation of lymphocyte migration | 4.65e-03 |
| BCR | GO:0007160 | cell-matrix adhesion | 4.67e-03 |
| BCR | GO:0071219 | cellular response to molecule of bacterial origin | 4.67e-03 |
Top |
Related Drugs to BCR_RALGPS1 |
Drugs used for this fusion-positive patient. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
| Hgene | Tgene | Drug | Source | PMID |
Distribution of the number of studies mentioning BCR-RALGPS1 and kinase inhibitors the PubMed Abstract (04-01-2024) |
| Fusion gene - drug pair 1 | Fusion gene - drug pair 2 | PMID | Publication date | DOI | Study title |
Top |
Related Diseases to BCR_RALGPS1 |
Diseases that have this fusion gene. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
| Hgene | Tgene | Disease | Source | PMID |
Related diseases from the literature mentioned this fusion gene and drug. (PubMed, 04-01-2024) |
| MeSH ID | MeSH term |
Diseases associated with fusion partners. (DisGeNet 4.0) |
| Partner | Gene | Disease ID | Disease name | # pubmeds | Source |
| Hgene | BCR | C0005586 | Bipolar Disorder | 4 | PSYGENET |
| Hgene | BCR | C0023473 | Myeloid Leukemia, Chronic | 3 | CTD_human;ORPHANET |
Top |
Clinical Trials of the Found Drugs/Small Molecules |
Statistics of the Clinical Trials of the Found Kinase Inibitors from clinicaltrials.gov (06-17-2024) |
Clinical Trials from clinicaltrials.gov (06-17-2024) |
| Fusion Gene | Kinase Inhibitor | NCT ID | Study Status | Phases | Disease | # Enrolment | Date |