UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
|
Kinase Fusion Gene:STK3_NIPAL2 |
Kinase Fusion Protein Summary |
Kinase Fusion gene summary |
Kinase Fusion partner gene information | Kinase Fusion gene name: STK3_NIPAL2 | KinaseFusionDB ID: KFG6248 | FusionGDB2.0 ID: KFG6248 | Hgene | Tgene | Gene symbol | STK3 | NIPAL2 | Gene ID | 8428 | 79815 | |
Gene name | serine/threonine kinase 24 | NIPA like domain containing 2 | ||||||||||
Synonyms | HEL-S-95|MST3|MST3B|STE20|STK3 | NPAL2|SLC57A4 | ||||||||||
Cytomap | 13q32.2 | 8q22.2 | ||||||||||
Type of gene | protein-coding | protein-coding | ||||||||||
Description | serine/threonine-protein kinase 24STE20-like kinase 3STE20-like kinase MST3epididymis secretory protein Li 95mammalian STE20-like protein kinase 3serine/threonine kinase 24 (STE20 homolog, yeast)sterile 20-like kinase 3 | NIPA-like protein 2 | ||||||||||
Modification date | 20240411 | 20240305 | ||||||||||
UniProtAcc | Q9UEW8 | Q9H841 | ||||||||||
Ensembl transtripts involved in fusion gene | ENST ids | ENST00000419617, ENST00000523601, ENST00000521768, | ENST00000520545, ENST00000341166, ENST00000430223, | |||||||||
Context (manual curation of fusion genes in KinaseFusionDB) | PubMed: STK3 [Title/Abstract] AND NIPAL2 [Title/Abstract] AND fusion [Title/Abstract] | |||||||||||
Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) | STK3(99538969)-NIPAL2(99266315), # samples:2 |
Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
Partner | Gene | GO ID | GO term | PubMed ID |
Hgene | STK3 | GO:0006468 | protein phosphorylation | 19604147 |
Hgene | STK3 | GO:0034599 | cellular response to oxidative stress | 22291017 |
Hgene | STK3 | GO:0046777 | protein autophosphorylation | 17046825|17657516 |
Kinase Fusion gene breakpoints across STK3 (5'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Kinase Fusion gene breakpoints across NIPAL2 (3'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Top |
Kinase Fusion Gene Sample Information |
Kinase Fusion gene information. |
Kinase Fusion gene information from four resources (ChiTars 5.0, ChimerDB 4.0, COSMIC, and CCLE) * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
Source | Sample | Hgene | Hchr | Hbp | Tgene | Tchr | Tbp |
ChimerDB4 | TCGA-25-1632 | STK3 | chr8 | 99538969 | NIPAL2 | chr8 | 99224729 |
ChimerDB4 | TCGA-D7-6822-01A | STK3 | chr8 | 99837743 | NIPAL2 | chr8 | 99266315 |
ChimerDB4 | TCGA-IC-A6RE | STK3 | chr8 | 99538969 | NIPAL2 | chr8 | 99266315 |
Top |
Kinase Fusion ORF Analysis |
Kinase Fusion information from ORFfinder translation from full-length transcript sequence from KinaseFusionDB. |
Henst | Tenst | Hgene | Hchr | Hbp | Tgene | Tchr | Tbp | Seq length (transcript) | Seq length (amino acids) |
ENST00000419617 | ENST00000430223 | STK3 | chr8 | 99538969 | NIPAL2 | chr8 | 99266315 | 5620 | 809 |
ENST00000419617 | ENST00000430223 | STK3 | chr8 | 99538969 | NIPAL2 | chr8 | 99224729 | 5197 | 668 |
Top |
Kinase Fusion Amino Acid Sequences |
For individual full-length fusion transcript sequence from KinaseFusionDB, we ran ORFfinder and chose the longest ORF among the all predicted ones. |
>Henst_Tenst_Hgene_Hchr_Hbp_Tgene_Tchr_Tbp_length(fusion AA)_AAseq >ENST00000419617_ENST00000430223_STK3_chr8_99538969_NIPAL2_chr8_99266315_length(amino acids)=809 MWCPRLGRPVPRLLSSFRPSPSTRSLSLSPAAMEQPPAPKSKLKKLSEDSLTKQPEEVFDVLEKLGEGSYGSVFKAIHKESGQVVAIKQV PVESDLQEIIKEISIMQQCDSPYVVKYYGSYFKNTDLWIVMEYCGAGSVSDIIRLRNKTLIEDEIATILKSTLKGLEYLHFMRKIHRDIK AGNILLNTEGHAKLADFGVAGQLTDTMAKRNTVIGTPFWMAPEVIQEIGYNCVADIWSLGITSIEMAEGKPPYADIHPMRAIFMIPTNPP PTFRKPELWSDDFTDFVKKCLVKNPEQRATATQLLQHPFIKNAKPVSILRDLITEAMEIKAKRHEEQQRELEEEEENSDEDELDSHTMVK TSVESVGTMRATSTMSEGAQTMIEHNSTMLESDLGTMVINSEDEEEEDGTMKRNATSPQVQRPSFMDYFDKQDFKNKSHENCNQNMHEPF PMSKNVFPDNWKVPQDGDFDFIHLFGVLLAILGNLVISISLNIQKYSHLQLAQQEHPRPYFKSVLWWGGVLLMAVGETGNFAAYGFAPIT LIAPLGCVSVTGSAIISVTFLKDNLRASDLLGTTLAFAGTYLLVNFAPNITQAISARTVQYYLVGWQFLIYVILEILIFCILLYFYKRKG MKHMVILLTLVAILASLTVISVKAVSGMITFSVMDKMQLTYPIFYIMFIIMIASCVFQVKFLNQATKLYNTTTVVPVNHIFFTISAIIAG -------------------------------------------------------------- >ENST00000419617_ENST00000430223_STK3_chr8_99538969_NIPAL2_chr8_99224729_length(amino acids)=668 MWCPRLGRPVPRLLSSFRPSPSTRSLSLSPAAMEQPPAPKSKLKKLSEDSLTKQPEEVFDVLEKLGEGSYGSVFKAIHKESGQVVAIKQV PVESDLQEIIKEISIMQQCDSPYVVKYYGSYFKNTDLWIVMEYCGAGSVSDIIRLRNKTLIEDEIATILKSTLKGLEYLHFMRKIHRDIK AGNILLNTEGHAKLADFGVAGQLTDTMAKRNTVIGTPFWMAPEVIQEIGYNCVADIWSLGITSIEMAEGKPPYADIHPMRAIFMIPTNPP PTFRKPELWSDDFTDFVKKCLVKNPEQRATATQLLQHPFIKNAKPVSILRDLITEAMEIKAKRHEEQQRELEEEEENSDEDELDSHTMVK TSVESVGTMRATSTMSEGAQTMIEHNSTMLESDLGTMVINSEDEEEEDGTMKRNATSPQVQRPSFMDYFDKQDFKNKSHENCNQNMHEPF PMSKNVFPDNWKVPQDGDFDFILEILIFCILLYFYKRKGMKHMVILLTLVAILASLTVISVKAVSGMITFSVMDKMQLTYPIFYIMFIIM IASCVFQVKFLNQATKLYNTTTVVPVNHIFFTISAIIAGIIFYQEFLGAPFLTVFIYLFGCFLSFLGVFLVTRNREKEHLQQSYIDFGNI -------------------------------------------------------------- |
Multiple Sequence Alignment of All Fusion Protein Isoforms |
Top |
Kinase Fusion Protein Functional Features |
Four levels of functional features of fusion genes Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr8:99538969/chr8:99266315) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
Main function of each fusion partner protein. (from UniProt) |
Hgene | Tgene |
STK3 | NIPAL2 |
FUNCTION: Effector serine/threonine-protein kinase component of the WNK-SPAK/OSR1 kinase cascade, which is involved in various processes, such as ion transport, response to hypertonic stress and blood pressure (PubMed:16669787, PubMed:18270262, PubMed:21321328, PubMed:34289367). Specifically recognizes and binds proteins with a RFXV motif (PubMed:16669787, PubMed:21321328). Acts downstream of WNK kinases (WNK1, WNK2, WNK3 or WNK4): following activation by WNK kinases, catalyzes phosphorylation of ion cotransporters, such as SLC12A1/NKCC2, SLC12A2/NKCC1, SLC12A3/NCC, SLC12A5/KCC2 or SLC12A6/KCC3, regulating their activity (PubMed:21321328). Mediates regulatory volume increase in response to hyperosmotic stress by catalyzing phosphorylation of ion cotransporters SLC12A1/NKCC2, SLC12A2/NKCC1 and SLC12A6/KCC3 downstream of WNK1 and WNK3 kinases (PubMed:12740379, PubMed:16669787, PubMed:21321328). Phosphorylation of Na-K-Cl cotransporters SLC12A2/NKCC1 and SLC12A2/NKCC1 promote their activation and ion influx; simultaneously, phosphorylation of K-Cl cotransporters SLC12A5/KCC2 and SLC12A6/KCC3 inhibit their activity, blocking ion efflux (PubMed:16669787, PubMed:19665974, PubMed:21321328). Acts as a regulator of NaCl reabsorption in the distal nephron by mediating phosphorylation and activation of the thiazide-sensitive Na-Cl cotransporter SLC12A3/NCC in distal convoluted tubule cells of kidney downstream of WNK4 (PubMed:18270262). Mediates the inhibition of SLC4A4, SLC26A6 as well as CFTR activities (By similarity). Phosphorylates RELT (By similarity). {ECO:0000250|UniProtKB:Q9Z1W9, ECO:0000269|PubMed:12740379, ECO:0000269|PubMed:16669787, ECO:0000269|PubMed:18270262, ECO:0000269|PubMed:19665974, ECO:0000269|PubMed:21321328, ECO:0000269|PubMed:34289367}. |
Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
- Retained domain in the 5'-partner of fusion protein (protein functional feature from UniProt). |
Partner | Hgeneene | Hbp | Tgeneene | Tbp | ENST | BPexon | TotalExon | Protein feature loci | BPloci | TotalLen | Feature | Note |
Hgene | STK3 | 99538969 | NIPAL2 | 99224729 | ENST00000419617 | 10 | 11 | 27_278 | 4391 | 492 | Domain | Note=Protein kinase;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00159 |
Hgene | STK3 | 99538969 | NIPAL2 | 99266315 | ENST00000419617 | 10 | 11 | 27_278 | 4391 | 492 | Domain | Note=Protein kinase;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00159 |
- Retained domain in the 3'-partner of fusion protein (protein functional feature from UniProt). |
Partner | Hgeneene | Hbp | Tgeneene | Tbp | ENST | BPexon | TotalExon | Protein feature loci | BPloci | TotalLen | Feature | Note |
Top |
Kinase Fusion Protein Structures |
CIF files of the predicted kinase fusion proteins * Here we show the 3D structure of the fusion proteins using Mol*. AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Model confidence is shown from the pLDDT values per residue. pLDDT corresponds to the model’s prediction of its score on the local Distance Difference Test. It is a measure of local accuracy (from AlphfaFold website). To color code individual residues, we transformed individual PDB files into CIF format. |
Kinase Fusion protein CIF link (fusion AA seq ID in KinaseFusionDB) | Henst | Tenst | Hgene | Hchr | Hbp | Tgene | Tchr | Tbp | AA seq | Len(AA seq) |
PDB file >>>267_STK3_NIPAL2 | ENST00000419617 | ENST00000430223 | STK3 | chr8 | 99538969 | NIPAL2 | chr8 | 99224729 | MWCPRLGRPVPRLLSSFRPSPSTRSLSLSPAAMEQPPAPKSKLKKLSEDSLTKQPEEVFDVLEKLGEGSYGSVFKAIHKESGQVVAIKQV PVESDLQEIIKEISIMQQCDSPYVVKYYGSYFKNTDLWIVMEYCGAGSVSDIIRLRNKTLIEDEIATILKSTLKGLEYLHFMRKIHRDIK AGNILLNTEGHAKLADFGVAGQLTDTMAKRNTVIGTPFWMAPEVIQEIGYNCVADIWSLGITSIEMAEGKPPYADIHPMRAIFMIPTNPP PTFRKPELWSDDFTDFVKKCLVKNPEQRATATQLLQHPFIKNAKPVSILRDLITEAMEIKAKRHEEQQRELEEEEENSDEDELDSHTMVK TSVESVGTMRATSTMSEGAQTMIEHNSTMLESDLGTMVINSEDEEEEDGTMKRNATSPQVQRPSFMDYFDKQDFKNKSHENCNQNMHEPF PMSKNVFPDNWKVPQDGDFDFILEILIFCILLYFYKRKGMKHMVILLTLVAILASLTVISVKAVSGMITFSVMDKMQLTYPIFYIMFIIM IASCVFQVKFLNQATKLYNTTTVVPVNHIFFTISAIIAGIIFYQEFLGAPFLTVFIYLFGCFLSFLGVFLVTRNREKEHLQQSYIDFGNI | 668 |
3D view using mol* of 267_STK3_NIPAL2 | ||||||||||
PDB file >>>HKFP_384_STK3_NIPAL2 | ENST00000419617 | ENST00000430223 | STK3 | chr8 | 99538969 | NIPAL2 | chr8 | 99266315 | MWCPRLGRPVPRLLSSFRPSPSTRSLSLSPAAMEQPPAPKSKLKKLSEDSLTKQPEEVFDVLEKLGEGSYGSVFKAIHKESGQVVAIKQV PVESDLQEIIKEISIMQQCDSPYVVKYYGSYFKNTDLWIVMEYCGAGSVSDIIRLRNKTLIEDEIATILKSTLKGLEYLHFMRKIHRDIK AGNILLNTEGHAKLADFGVAGQLTDTMAKRNTVIGTPFWMAPEVIQEIGYNCVADIWSLGITSIEMAEGKPPYADIHPMRAIFMIPTNPP PTFRKPELWSDDFTDFVKKCLVKNPEQRATATQLLQHPFIKNAKPVSILRDLITEAMEIKAKRHEEQQRELEEEEENSDEDELDSHTMVK TSVESVGTMRATSTMSEGAQTMIEHNSTMLESDLGTMVINSEDEEEEDGTMKRNATSPQVQRPSFMDYFDKQDFKNKSHENCNQNMHEPF PMSKNVFPDNWKVPQDGDFDFIHLFGVLLAILGNLVISISLNIQKYSHLQLAQQEHPRPYFKSVLWWGGVLLMAVGETGNFAAYGFAPIT LIAPLGCVSVTGSAIISVTFLKDNLRASDLLGTTLAFAGTYLLVNFAPNITQAISARTVQYYLVGWQFLIYVILEILIFCILLYFYKRKG MKHMVILLTLVAILASLTVISVKAVSGMITFSVMDKMQLTYPIFYIMFIIMIASCVFQVKFLNQATKLYNTTTVVPVNHIFFTISAIIAG | 809_STK3_NIPAL2 |
PDB file >>>HKFP_385_STK3_NIPAL2 | ENST00000419617 | ENST00000430223 | STK3 | chr8 | 99538969 | NIPAL2 | chr8 | 99224729 | MWCPRLGRPVPRLLSSFRPSPSTRSLSLSPAAMEQPPAPKSKLKKLSEDSLTKQPEEVFDVLEKLGEGSYGSVFKAIHKESGQVVAIKQV PVESDLQEIIKEISIMQQCDSPYVVKYYGSYFKNTDLWIVMEYCGAGSVSDIIRLRNKTLIEDEIATILKSTLKGLEYLHFMRKIHRDIK AGNILLNTEGHAKLADFGVAGQLTDTMAKRNTVIGTPFWMAPEVIQEIGYNCVADIWSLGITSIEMAEGKPPYADIHPMRAIFMIPTNPP PTFRKPELWSDDFTDFVKKCLVKNPEQRATATQLLQHPFIKNAKPVSILRDLITEAMEIKAKRHEEQQRELEEEEENSDEDELDSHTMVK TSVESVGTMRATSTMSEGAQTMIEHNSTMLESDLGTMVINSEDEEEEDGTMKRNATSPQVQRPSFMDYFDKQDFKNKSHENCNQNMHEPF PMSKNVFPDNWKVPQDGDFDFILEILIFCILLYFYKRKGMKHMVILLTLVAILASLTVISVKAVSGMITFSVMDKMQLTYPIFYIMFIIM IASCVFQVKFLNQATKLYNTTTVVPVNHIFFTISAIIAGIIFYQEFLGAPFLTVFIYLFGCFLSFLGVFLVTRNREKEHLQQSYIDFGNI | 668_STK3_NIPAL2 |
3D view using mol* of HKFP_385_STK3_NIPAL2 | ||||||||||
Top |
Comparison of Fusion Protein Isoforms |
Superimpose the 3D Structures Among All Fusion Protein Isoforms * Download the pdb file and open it from the molstar online viewer. |
3D view using mol* of viewer/superimpose_isoforms/HKFP_384_STK3_NIPAL2_vs_HKFP_385_STK3_NIPAL2_superimposed.pdb.html |
Comparison of the Secondary Structures of Fusion Protein Isoforms |
./secondary_str/HKFP_385_STK3_NIPAL2_vs_HKFP_384_STK3_NIPAL2.png |
Top |
Comparison of Fusion Protein Sequences/Structures with Known Sequences/Structures from PDB |
Top |
pLDDT score distribution |
pLDDT score distribution of the predicted fusion protein structures from AlphaFold2 * AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. * The blue color at the bottom marks the best active site residues. |
267_STK3_NIPAL2.png |
267_STK3_NIPAL2.png |
HKFP_385_STK3_NIPAL2.png |
Top |
Potential Active Site Information |
The potential binding sites of these fusion proteins were identified using SiteMap, a module of the Schrodinger suite. |
Kinase Fusion AA seq ID in KinaseFusionDB | Site score | Size | Dscore | Volume | Exposure | Enclosure | Contact | Phobic | Philic | Balance | Don/Acc | Residues |
HKFP_385_STK3_NIPAL2 | 1.089 | 183 | 1.17 | 606.424 | 0.507 | 0.7 | 0.943 | 1.283 | 0.582 | 2.206 | 1.384 | Chain A: 455,457,458,459,461,462,463,464,466,467,4 68,469,470,471,509,512,513,515,516,517,519,520,527 ,530,532,536,578,581,582,583,584 |
Top |
Ramachandran Plot of Kinase Fusion Protein Structure |
Ramachandran plot of the torsional angles - phi (φ)and psi (ψ) - of the residues (amino acids) contained in this fusion protein peptide. |
267_STK3_NIPAL2_ramachandran.png |
HKFP_385_STK3_NIPAL2_ramachandran.png |
Top |
Virtual Screening Results |
Distribution of the average docking score across all approved kinase inhibitors. Distribution of the number of occurrence across all approved kinase inhibitors. |
5'-kinase fusion protein case |
3'-kinase fusion protein case |
Top |
Drug information from DrugBank of the top 20 interacting small molecules. * The detailed information of individual kinase inhibitors are available in the download page. |
Fusion gene name info | Drug | Docking score | Glide g score | Glide energy |
HKFP_385_STK3_NIPAL2_vsw_8-DOCK_HTVS_1-001 | Nilotinib | -9.12591 | -9.26551 | -55.2517 |
HKFP_385_STK3_NIPAL2_vsw_8-DOCK_HTVS_1-001 | Nilotinib | -9.12591 | -9.26551 | -55.2517 |
HKFP_385_STK3_NIPAL2_vsw_8-DOCK_HTVS_1-001 | Lapatinib | -8.72797 | -8.81677 | -58.8461 |
HKFP_385_STK3_NIPAL2_vsw_8-DOCK_HTVS_1-001 | Midostaurin | -8.705910000000001 | -8.705910000000001 | -23.6934 |
HKFP_385_STK3_NIPAL2_vsw_8-DOCK_HTVS_1-001 | Ripretinib | -8.37984 | -8.38684 | -49.9332 |
HKFP_385_STK3_NIPAL2_vsw_8-DOCK_HTVS_1-001 | Ripretinib | -8.37984 | -8.38684 | -49.9332 |
HKFP_385_STK3_NIPAL2_vsw_8-DOCK_HTVS_1-001 | Larotrectinib | -8.15513 | -8.15513 | -47.01 |
HKFP_385_STK3_NIPAL2_vsw_8-DOCK_HTVS_1-001 | Midostaurin | -8.04251 | -8.04251 | -22.5559 |
HKFP_385_STK3_NIPAL2_vsw_8-DOCK_HTVS_1-001 | Nilotinib | -7.969410000000001 | -8.894210000000003 | -45.5425 |
HKFP_385_STK3_NIPAL2_vsw_8-DOCK_HTVS_1-001 | Nilotinib | -7.969410000000001 | -8.894210000000003 | -45.5425 |
HKFP_385_STK3_NIPAL2_vsw_8-DOCK_HTVS_1-001 | Larotrectinib | -7.86687 | -7.86687 | -47.9012 |
HKFP_385_STK3_NIPAL2_vsw_8-DOCK_HTVS_1-001 | Entrectinib | -7.8593899999999985 | -7.92409 | -52.1164 |
HKFP_385_STK3_NIPAL2_vsw_8-DOCK_HTVS_1-001 | Entrectinib | -7.8593899999999985 | -7.92409 | -52.1164 |
HKFP_385_STK3_NIPAL2_vsw_8-DOCK_HTVS_1-001 | Pemigatinib | -7.79378 | -7.87648 | -46.87300000000001 |
HKFP_385_STK3_NIPAL2_vsw_8-DOCK_HTVS_1-001 | Pemigatinib | -7.79378 | -7.87648 | -46.87300000000001 |
HKFP_385_STK3_NIPAL2_vsw_8-DOCK_HTVS_1-001 | Pemigatinib | -7.79378 | -7.87648 | -46.87300000000001 |
HKFP_385_STK3_NIPAL2_vsw_8-DOCK_HTVS_1-001 | Crizotinib | -7.77635 | -8.11255 | -43.8365 |
HKFP_385_STK3_NIPAL2_vsw_8-DOCK_HTVS_1-001 | Crizotinib | -7.77635 | -8.11255 | -43.8365 |
HKFP_385_STK3_NIPAL2_vsw_8-DOCK_HTVS_1-001 | Netarsudil | -7.622789999999998 | -7.633889999999999 | -50.2951 |
HKFP_385_STK3_NIPAL2_vsw_8-DOCK_HTVS_1-001 | Netarsudil | -7.622789999999998 | -7.633889999999999 | -50.2951 |
267_STK3_NIPAL2-DOCK_HTVS_1-001 | Ponatinib | -7.66136 | -7.867960000000001 | -40.233000000000004 |
267_STK3_NIPAL2-DOCK_HTVS_1-001 | Ponatinib | -7.66136 | -7.867960000000001 | -40.233000000000004 |
267_STK3_NIPAL2-DOCK_HTVS_1-001 | Ponatinib | -7.66136 | -7.867960000000001 | -40.233000000000004 |
267_STK3_NIPAL2-DOCK_HTVS_1-001 | Tofacitinib | -7.60284 | -7.614339999999999 | -28.919 |
267_STK3_NIPAL2-DOCK_HTVS_1-001 | Tofacitinib | -7.60284 | -7.614339999999999 | -28.919 |
267_STK3_NIPAL2-DOCK_HTVS_1-001 | Cabozantinib | -7.1127199999999995 | -7.157719999999999 | -44.04600000000001 |
267_STK3_NIPAL2-DOCK_HTVS_1-001 | Cabozantinib | -7.1127199999999995 | -7.157719999999999 | -44.04600000000001 |
267_STK3_NIPAL2-DOCK_HTVS_1-001 | Dacomitinib | -6.949339999999999 | -7.057639999999999 | -36.5874 |
267_STK3_NIPAL2-DOCK_HTVS_1-001 | Dacomitinib | -6.949339999999999 | -7.057639999999999 | -36.5874 |
267_STK3_NIPAL2-DOCK_HTVS_1-001 | Dacomitinib | -6.948639999999999 | -7.057639999999999 | -36.5874 |
267_STK3_NIPAL2-DOCK_HTVS_1-001 | Encorafenib | -6.8086199999999995 | -7.19712 | -47.4432 |
267_STK3_NIPAL2-DOCK_HTVS_1-001 | Osimertinib | -6.71139 | -6.71909 | -48.3558 |
267_STK3_NIPAL2-DOCK_HTVS_1-001 | Binimetinib | -6.6784 | -6.6871 | -38.2166 |
267_STK3_NIPAL2-DOCK_HTVS_1-001 | Binimetinib | -6.6784 | -6.6871 | -38.2166 |
267_STK3_NIPAL2-DOCK_HTVS_1-001 | Regorafenib | -6.30375 | -6.30375 | -50.972 |
267_STK3_NIPAL2-DOCK_HTVS_1-001 | Larotrectinib | -6.23735 | -6.23735 | -21.845 |
267_STK3_NIPAL2-DOCK_HTVS_1-001 | Axitinib | -6.09524 | -6.09844 | -28.3022 |
267_STK3_NIPAL2-DOCK_HTVS_1-001 | Tofacitinib | -6.04946 | -6.06096 | -35.8544 |
267_STK3_NIPAL2-DOCK_HTVS_1-001 | Tofacitinib | -6.04946 | -6.06096 | -35.8544 |
267_STK3_NIPAL2-DOCK_HTVS_1-001 | Selumetinib | -6.01361 | -6.02231 | -40.5804 |
Top |
Kinase-Substrate Information of STK3_NIPAL2 |
Phosphorylation target of the kinase (phosphosite, 03-17-2024) |
Kinase | Kinase UniProt Acc | Kinase species | Substrate | Substrate UniProt Acc | Substrate phosphorylated residues | Substrate phosphorylated sites (+/-7AA) | Domain |
STK3 | Q13188 | human | NR3C1 | P04150 | S682 | VPkDGLksQELFDEI | Hormone_recep |
STK3 | Q13188 | human | PRKCA | P17252 | S226 | LNPQWNEsFtFkLKP | C2 |
STK3 | Q13188 | human | ABL1 | P00519 | T735 | DTEWRSVtLPRDLQS | |
STK3 | Q13188 | human | MOB1B | Q7L9L4 | T74 | QINMLYGtITDFCTE | Mob1_phocein |
STK3 | Q13188 | human | SAV1 | Q9H4B6 | S36 | LLRNLMPsFIRHGPT | |
STK3 | Q13188 | human | NR3C1 | P04150 | T562 | StWRIMTtLNMLGGR | Hormone_recep |
STK3 | Q13188 | human | MOB1A | Q9H8S9 | T35 | LLkHAEAtLGsGNLR | Mob1_phocein |
STK3 | Q13188 | human | OBSCN | Q5VST9 | T5798 | AESVVVStAIQEFYK | |
STK3 | Q13188 | human | NEK2 | P51955 | S406 | NsEsQLtsksKCKDL | |
STK3 | Q13188 | human | MOB1A | Q9H8S9 | T12 | FsSRssktFKPkkNI | |
STK3 | Q13188 | human | LATS1 | O95835 | S909 | HQRCLAHsLVGTPNY | Pkinase |
STK3 | Q13188 | human | PRKAA1 | Q13131 | T183 | sDGEFLRtsCGsPNy | Pkinase |
STK3 | Q13188 | human | PRKCA | P17252 | T228 | PQWNEsFtFkLKPsD | C2 |
STK3 | Q13188 | human | SAV1 | Q9H4B6 | S269 | YRHPCAPsVPRyDQP | |
STK3 | Q13188 | human | STK3 | Q13188 | T378 | DEEEEDGtMKRNAts | |
STK3 | Q13188 | human | SAV1 | Q9H4B6 | T26 | GKYVKKEtsPLLRNL | |
STK3 | Q13188 | human | NR3C1 | P04150 | T668 | EEYLCMKtLLLLSSV | Hormone_recep |
STK3 | Q13188 | human | LATS1 | O95835 | T967 | MKVINWQtSLHIPPQ | Pkinase |
STK3 | Q13188 | human | YAP1 | P46937 | S127 | PQHVRAHssPAsLQL | |
STK3 | Q13188 | human | SAV1 | Q9H4B6 | S27 | KYVKKEtsPLLRNLM | |
STK3 | Q13188 | human | LATS1 | O95835 | T1079 | EHAFyEFtFRRFFDD | |
STK3 | Q13188 | human | NEK2 | P51955 | S365 | LkERkFLsLASNPEL | |
STK3 | Q13188 | human | STAT3 | P40763 | T622 | kEGGVTFtWVEkDIS | SH2 |
STK3 | Q13188 | human | LATS1 | O95835 | T1060 | EEENVNDtLNGWYKN | |
STK3 | Q13188 | human | MOB1A | Q9H8S9 | T74 | QINMLYGtITEFCTE | Mob1_phocein |
STK3 | Q13188 | human | NEK2 | P51955 | S356 | ENLLkNYsLLkERkF | |
STK3 | Q13188 | human | NR3C1 | P04150 | S746 | TFLDKTMsIEFPEML | |
STK3 | Q13188 | human | MAP1LC3B | Q9GZQ8 | T50 | QLPVLDktkFLVPDH | ATG8 |
STK3 | Q13188 | human | MOB1B | Q7L9L4 | T35 | LLkHAEAtLGsGNLR | Mob1_phocein |
STK3 | Q13188 | human | STK3 | Q13188 | T180 | DtMAkRNtVIGTPFW | Pkinase |
STK3 | Q13188 | human | SIK3 | Q9Y2K2 | T221 | TPGQLLKtWCGSPPY | Pkinase |
STK3 | Q13188 | human | LATS1 | O95835 | T1012 | kAHPFFKtIDFSSDL | |
STK3 | Q13188 | human | LATS1 | O95835 | S872 | GDHPRQDsMDFSNEW | Pkinase |
STK3 | Q13188 | human | NEK2 | P51955 | S438 | EkNYQLksRQILGMR | |
STK3 | Q13188 | human | MOB1B | Q7L9L4 | T12 | FGsRssktFKPkkNI |
Biological Network Integration of This Kinase and Substrates (GeneMANIA website) |
Enriched GO biological processes of the phosphorylation target genes of the kinase |
Kinase | GOID | GO term | P.adjust |
STK3 | ID | Description | 0.00e+00 |
STK3 | GO:0035329 | hippo signaling | 6.70e-10 |
STK3 | GO:1904019 | epithelial cell apoptotic process | 4.11e-05 |
STK3 | GO:0048638 | regulation of developmental growth | 4.65e-05 |
STK3 | GO:0035265 | organ growth | 5.76e-05 |
STK3 | GO:0046620 | regulation of organ growth | 2.25e-04 |
STK3 | GO:1904035 | regulation of epithelial cell apoptotic process | 3.18e-04 |
STK3 | GO:0050678 | regulation of epithelial cell proliferation | 1.94e-03 |
STK3 | GO:0060038 | cardiac muscle cell proliferation | 1.94e-03 |
STK3 | GO:1904036 | negative regulation of epithelial cell apoptotic process | 2.21e-03 |
STK3 | GO:0016055 | Wnt signaling pathway | 2.29e-03 |
STK3 | GO:0198738 | cell-cell signaling by wnt | 2.29e-03 |
STK3 | GO:0050673 | epithelial cell proliferation | 2.55e-03 |
STK3 | GO:2000736 | regulation of stem cell differentiation | 2.77e-03 |
STK3 | GO:0014855 | striated muscle cell proliferation | 3.10e-03 |
STK3 | GO:0048708 | astrocyte differentiation | 3.33e-03 |
STK3 | GO:0055017 | cardiac muscle tissue growth | 3.34e-03 |
STK3 | GO:0060419 | heart growth | 4.07e-03 |
STK3 | GO:0071560 | cellular response to transforming growth factor beta stimulus | 4.20e-03 |
STK3 | GO:0071559 | response to transforming growth factor beta | 4.31e-03 |
STK3 | GO:0034504 | protein localization to nucleus | 5.10e-03 |
STK3 | GO:0001824 | blastocyst development | 5.61e-03 |
STK3 | GO:0060562 | epithelial tube morphogenesis | 5.70e-03 |
STK3 | GO:0030518 | intracellular steroid hormone receptor signaling pathway | 5.70e-03 |
STK3 | GO:0002065 | columnar/cuboidal epithelial cell differentiation | 5.70e-03 |
STK3 | GO:0030111 | regulation of Wnt signaling pathway | 5.70e-03 |
STK3 | GO:0097284 | hepatocyte apoptotic process | 5.70e-03 |
STK3 | GO:0030522 | intracellular receptor signaling pathway | 6.24e-03 |
STK3 | GO:0061744 | motor behavior | 6.37e-03 |
STK3 | GO:0043401 | steroid hormone mediated signaling pathway | 6.80e-03 |
STK3 | GO:0070102 | interleukin-6-mediated signaling pathway | 7.27e-03 |
STK3 | GO:2000737 | negative regulation of stem cell differentiation | 7.27e-03 |
STK3 | GO:0045598 | regulation of fat cell differentiation | 7.27e-03 |
STK3 | GO:0001701 | in utero embryonic development | 7.39e-03 |
STK3 | GO:0060479 | lung cell differentiation | 7.39e-03 |
STK3 | GO:0060487 | lung epithelial cell differentiation | 7.39e-03 |
STK3 | GO:0060575 | intestinal epithelial cell differentiation | 7.39e-03 |
STK3 | GO:0060537 | muscle tissue development | 9.96e-03 |
STK3 | GO:0030216 | keratinocyte differentiation | 1.07e-02 |
STK3 | GO:0033146 | regulation of intracellular estrogen receptor signaling pathway | 1.07e-02 |
STK3 | GO:0019827 | stem cell population maintenance | 1.09e-02 |
STK3 | GO:0046621 | negative regulation of organ growth | 1.09e-02 |
STK3 | GO:0045766 | positive regulation of angiogenesis | 1.09e-02 |
STK3 | GO:1904018 | positive regulation of vasculature development | 1.09e-02 |
STK3 | GO:0098727 | maintenance of cell number | 1.09e-02 |
STK3 | GO:0006109 | regulation of carbohydrate metabolic process | 1.09e-02 |
STK3 | GO:0009755 | hormone-mediated signaling pathway | 1.15e-02 |
STK3 | GO:0071354 | cellular response to interleukin-6 | 1.16e-02 |
STK3 | GO:0046777 | protein autophosphorylation | 1.20e-02 |
STK3 | GO:0071383 | cellular response to steroid hormone stimulus | 1.27e-02 |
Top |
Related Drugs to STK3_NIPAL2 |
Drugs used for this fusion-positive patient. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Drug | Source | PMID |
Distribution of the number of studies mentioning STK3-NIPAL2 and kinase inhibitors the PubMed Abstract (04-01-2024) |
Fusion gene - drug pair 1 | Fusion gene - drug pair 2 | PMID | Publication date | DOI | Study title |
Top |
Related Diseases to STK3_NIPAL2 |
Diseases that have this fusion gene. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Disease | Source | PMID |
Related diseases from the literature mentioned this fusion gene and drug. (PubMed, 04-01-2024) |
MeSH ID | MeSH term |
Diseases associated with fusion partners. (DisGeNet 4.0) |
Partner | Gene | Disease ID | Disease name | # pubmeds | Source |
Top |
Clinical Trials of the Found Drugs/Small Molecules |
Statistics of the Clinical Trials of the Found Kinase Inibitors from clinicaltrials.gov (06-17-2024) |
Clinical Trials from clinicaltrials.gov (06-17-2024) |
Fusion Gene | Kinase Inhibitor | NCT ID | Study Status | Phases | Disease | # Enrolment | Date |