UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
|
Kinase Fusion Gene:TAF1C_ARAF |
Kinase Fusion Protein Summary |
Kinase Fusion gene summary |
Kinase Fusion partner gene information | Kinase Fusion gene name: TAF1C_ARAF | KinaseFusionDB ID: KFG6343 | FusionGDB2.0 ID: KFG6343 | Hgene | Tgene | Gene symbol | TAF1C | ARAF | Gene ID | 9013 | 369 | |
Gene name | TATA-box binding protein associated factor, RNA polymerase I subunit C | A-Raf proto-oncogene, serine/threonine kinase | ||||||||||
Synonyms | MGC:39976|SL1|TAFI110|TAFI95 | A-RAF|ARAF1|PKS2|RAFA1 | ||||||||||
Cytomap | 16q24.1 | Xp11.3 | ||||||||||
Type of gene | protein-coding | protein-coding | ||||||||||
Description | TATA box-binding protein-associated factor RNA polymerase I subunit CRNA polymerase I-specific TBP-associated factor 110 kDaSL1, 110kD subunitTATA box binding protein (TBP)-associated factor, RNA polymerase I, C, 110kDTATA box binding protein (TBP)-as | serine/threonine-protein kinase A-RafA-Raf proto-oncogene serine/threonine-protein kinaseOncogene ARAF1Ras-binding protein DA-Rafproto-oncogene A-Raf-1proto-oncogene Pksv-raf murine sarcoma 3611 viral oncogene homolog 1v-raf murine sarcoma 3611 vir | ||||||||||
Modification date | 20240411 | 20240407 | ||||||||||
UniProtAcc | Q15572 | P10398 | ||||||||||
Ensembl transtripts involved in fusion gene | ENST ids | ENST00000341690, ENST00000378541, ENST00000541676, ENST00000566732, ENST00000567759, ENST00000570117, ENST00000565544, | ENST00000290277, ENST00000377039, ENST00000470206, ENST00000377045, | |||||||||
Context (manual curation of fusion genes in KinaseFusionDB) | PubMed: TAF1C [Title/Abstract] AND ARAF [Title/Abstract] AND fusion [Title/Abstract] | |||||||||||
Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) | TAF1C(84215807)-ARAF(47428937), # samples:1 |
Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
Partner | Gene | GO ID | GO term | PubMed ID |
Tgene | ARAF | GO:0033138 | positive regulation of peptidyl-serine phosphorylation | 19667065 |
Tgene | ARAF | GO:0043066 | negative regulation of apoptotic process | 19667065 |
Kinase Fusion gene breakpoints across TAF1C (5'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Kinase Fusion gene breakpoints across ARAF (3'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Top |
Kinase Fusion Gene Sample Information |
Kinase Fusion gene information. |
Kinase Fusion gene information from four resources (ChiTars 5.0, ChimerDB 4.0, COSMIC, and CCLE) * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
Source | Sample | Hgene | Hchr | Hbp | Tgene | Tchr | Tbp |
ChimerDB4 | TCGA-FP-A8CX | TAF1C | chr16 | 84215807 | ARAF | chrX | 47428937 |
Top |
Kinase Fusion ORF Analysis |
Kinase Fusion information from ORFfinder translation from full-length transcript sequence from KinaseFusionDB. |
Henst | Tenst | Hgene | Hchr | Hbp | Tgene | Tchr | Tbp | Seq length (transcript) | Seq length (amino acids) |
ENST00000378541 | ENST00000377045 | TAF1C | chr16 | 84215807 | ARAF | chrX | 47428937 | 1685 | 413 |
Top |
Kinase Fusion Amino Acid Sequences |
For individual full-length fusion transcript sequence from KinaseFusionDB, we ran ORFfinder and chose the longest ORF among the all predicted ones. |
>Henst_Tenst_Hgene_Hchr_Hbp_Tgene_Tchr_Tbp_length(fusion AA)_AAseq >ENST00000378541_ENST00000377045_TAF1C_chr16_84215807_ARAF_chrX_47428937_length(amino acids)=413 MDFPSSLRPALFLTGPLGLSDVPDLSFMCSWRDALTLPEAQPQNSENGALHVTKDLLWEPATPGPLPMLPPLIDPWDPGLTARDLLFRGG CRYRKRPRVVLDVTEQISRFLLDHGDVAFAPLGKLMLENFKLEGAGSRTKKKTVVSVKKLLQDLGGHQPWGCPWAYLSNRQRRFSILGGP ILGTSVASHLAELLHEELVLRWEQLLLDEACTGGALAWVPGRTPQFGQLVYPAGGAQDRLHIFLHEGLTVKIGDFGLATVKTRWSGAQPL EQPSGSVLWMAAEVIRMQDPNPYSFQSDVYAYGVVLYELMTGSLPYSHIGCRDQIIFMVGRGYLSPDLSKISSNCPKAMRRLLSDCLKFQ -------------------------------------------------------------- |
Multiple Sequence Alignment of All Fusion Protein Isoforms |
Top |
Kinase Fusion Protein Functional Features |
Four levels of functional features of fusion genes Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr16:84215807/chrX:47428937) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
Main function of each fusion partner protein. (from UniProt) |
Hgene | Tgene |
TAF1C | ARAF |
FUNCTION: Component of the transcription factor SL1/TIF-IB complex, which is involved in the assembly of the PIC (preinitiation complex) during RNA polymerase I-dependent transcription. The rate of PIC formation probably is primarily dependent on the rate of association of SL1/TIF-IB with the rDNA promoter. SL1/TIF-IB is involved in stabilization of nucleolar transcription factor 1/UBTF on rDNA. Formation of SL1/TIF-IB excludes the association of TBP with TFIID subunits. Recruits RNA polymerase I to the rRNA gene promoter via interaction with RRN3. {ECO:0000269|PubMed:11250903, ECO:0000269|PubMed:15970593}. | FUNCTION: Involved in the transduction of mitogenic signals from the cell membrane to the nucleus. May also regulate the TOR signaling cascade. Phosphorylates PFKFB2 (PubMed:36402789). {ECO:0000269|PubMed:22609986, ECO:0000269|PubMed:36402789}.; FUNCTION: [Isoform 2]: Serves as a positive regulator of myogenic differentiation by inducing cell cycle arrest, the expression of myogenin and other muscle-specific proteins, and myotube formation. {ECO:0000269|PubMed:22609986}. |
Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
- Retained domain in the 5'-partner of fusion protein (protein functional feature from UniProt). |
Partner | Hgeneene | Hbp | Tgeneene | Tbp | ENST | BPexon | TotalExon | Protein feature loci | BPloci | TotalLen | Feature | Note |
- Retained domain in the 3'-partner of fusion protein (protein functional feature from UniProt). |
Partner | Hgeneene | Hbp | Tgeneene | Tbp | ENST | BPexon | TotalExon | Protein feature loci | BPloci | TotalLen | Feature | Note |
Tgene | TAF1C | 84215807 | ARAF | 47428937 | ENST00000378541 | 0 | 6 | 310_570 | 0 | 187 | Domain | Note=Protein kinase;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00159 |
Tgene | TAF1C | 84215807 | ARAF | 47428937 | ENST00000378541 | 0 | 6 | 19_91 | 0 | 187 | Domain | Note=RBD;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00262 |
Top |
Kinase Fusion Protein Structures |
CIF files of the predicted kinase fusion proteins * Here we show the 3D structure of the fusion proteins using Mol*. AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Model confidence is shown from the pLDDT values per residue. pLDDT corresponds to the model’s prediction of its score on the local Distance Difference Test. It is a measure of local accuracy (from AlphfaFold website). To color code individual residues, we transformed individual PDB files into CIF format. |
Kinase Fusion protein CIF link (fusion AA seq ID in KinaseFusionDB) | Henst | Tenst | Hgene | Hchr | Hbp | Tgene | Tchr | Tbp | AA seq | Len(AA seq) |
PDB file >>>490_TAF1C_ARAF | ENST00000378541 | ENST00000377045 | TAF1C | chr16 | 84215807 | ARAF | chrX | 47428937 | MDFPSSLRPALFLTGPLGLSDVPDLSFMCSWRDALTLPEAQPQNSENGALHVTKDLLWEPATPGPLPMLPPLIDPWDPGLTARDLLFRGG CRYRKRPRVVLDVTEQISRFLLDHGDVAFAPLGKLMLENFKLEGAGSRTKKKTVVSVKKLLQDLGGHQPWGCPWAYLSNRQRRFSILGGP ILGTSVASHLAELLHEELVLRWEQLLLDEACTGGALAWVPGRTPQFGQLVYPAGGAQDRLHIFLHEGLTVKIGDFGLATVKTRWSGAQPL EQPSGSVLWMAAEVIRMQDPNPYSFQSDVYAYGVVLYELMTGSLPYSHIGCRDQIIFMVGRGYLSPDLSKISSNCPKAMRRLLSDCLKFQ | 413 |
3D view using mol* of 490_TAF1C_ARAF | ||||||||||
PDB file >>>TKFP_827_TAF1C_ARAF | ENST00000378541 | ENST00000377045 | TAF1C | chr16 | 84215807 | ARAF | chrX | 47428937 | MDFPSSLRPALFLTGPLGLSDVPDLSFMCSWRDALTLPEAQPQNSENGALHVTKDLLWEPATPGPLPMLPPLIDPWDPGLTARDLLFRGG CRYRKRPRVVLDVTEQISRFLLDHGDVAFAPLGKLMLENFKLEGAGSRTKKKTVVSVKKLLQDLGGHQPWGCPWAYLSNRQRRFSILGGP ILGTSVASHLAELLHEELVLRWEQLLLDEACTGGALAWVPGRTPQFGQLVYPAGGAQDRLHIFLHEGLTVKIGDFGLATVKTRWSGAQPL EQPSGSVLWMAAEVIRMQDPNPYSFQSDVYAYGVVLYELMTGSLPYSHIGCRDQIIFMVGRGYLSPDLSKISSNCPKAMRRLLSDCLKFQ | 413_TAF1C_ARAF |
Top |
Comparison of Fusion Protein Isoforms |
Superimpose the 3D Structures Among All Fusion Protein Isoforms * Download the pdb file and open it from the molstar online viewer. |
Comparison of the Secondary Structures of Fusion Protein Isoforms |
Top |
Comparison of Fusion Protein Sequences/Structures with Known Sequences/Structures from PDB |
Top |
pLDDT score distribution |
pLDDT score distribution of the predicted fusion protein structures from AlphaFold2 * AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. * The blue color at the bottom marks the best active site residues. |
490_TAF1C_ARAF.png |
490_TAF1C_ARAF.png |
Top |
Potential Active Site Information |
The potential binding sites of these fusion proteins were identified using SiteMap, a module of the Schrodinger suite. |
Kinase Fusion AA seq ID in KinaseFusionDB | Site score | Size | Dscore | Volume | Exposure | Enclosure | Contact | Phobic | Philic | Balance | Don/Acc | Residues |
Top |
Ramachandran Plot of Kinase Fusion Protein Structure |
Ramachandran plot of the torsional angles - phi (φ)and psi (ψ) - of the residues (amino acids) contained in this fusion protein peptide. |
490_TAF1C_ARAF_ramachandran.png |
Top |
Virtual Screening Results |
Distribution of the average docking score across all approved kinase inhibitors. Distribution of the number of occurrence across all approved kinase inhibitors. |
5'-kinase fusion protein case |
3'-kinase fusion protein case |
Top |
Drug information from DrugBank of the top 20 interacting small molecules. * The detailed information of individual kinase inhibitors are available in the download page. |
Fusion gene name info | Drug | Docking score | Glide g score | Glide energy |
Top |
Kinase-Substrate Information of TAF1C_ARAF |
Phosphorylation target of the kinase (phosphosite, 03-17-2024) |
Kinase | Kinase UniProt Acc | Kinase species | Substrate | Substrate UniProt Acc | Substrate phosphorylated residues | Substrate phosphorylated sites (+/-7AA) | Domain |
ARAF | P10398 | human | MAP2K1 | Q02750 | S222 | LIDsMANsFVGtRSY | Pkinase |
ARAF | P10398 | human | MAP2K1 | Q02750 | S218 | VsGQLIDsMANsFVG | Pkinase |
ARAF | P10398 | human | BAD | Q92934 | S99 | PFrGrsRsAPPNLWA | Bcl-2_BAD |
ARAF | P10398 | human | BAD | Q92934 | S75 | EIRsRHssyPAGtED | Bcl-2_BAD |
ARAF | P10398 | human | SLC9A3R2 | Q15599 | S303 | QEsGLHLsPtAAEAK | EBP50_C |
ARAF | P10398 | human | BAD | Q92934 | S118 | GRELRRMsDEFVDsF | Bcl-2_BAD |
Biological Network Integration of This Kinase and Substrates (GeneMANIA website) |
Enriched GO biological processes of the phosphorylation target genes of the kinase |
Kinase | GOID | GO term | P.adjust |
ARAF | ID | Description | 0.00e+00 |
ARAF | GO:0044342 | type B pancreatic cell proliferation | 5.44e-04 |
ARAF | GO:0035270 | endocrine system development | 6.90e-03 |
ARAF | GO:0033674 | positive regulation of kinase activity | 2.26e-02 |
ARAF | GO:0051347 | positive regulation of transferase activity | 2.26e-02 |
ARAF | GO:0010720 | positive regulation of cell development | 2.26e-02 |
ARAF | GO:0050673 | epithelial cell proliferation | 2.26e-02 |
ARAF | GO:0008627 | intrinsic apoptotic signaling pathway in response to osmotic stress | 2.26e-02 |
ARAF | GO:0010918 | positive regulation of mitochondrial membrane potential | 2.26e-02 |
ARAF | GO:0060502 | epithelial cell proliferation involved in lung morphogenesis | 2.26e-02 |
ARAF | GO:0060020 | Bergmann glial cell differentiation | 2.26e-02 |
ARAF | GO:0060439 | trachea morphogenesis | 2.26e-02 |
ARAF | GO:0106049 | regulation of cellular response to osmotic stress | 2.26e-02 |
ARAF | GO:0097202 | activation of cysteine-type endopeptidase activity | 2.26e-02 |
ARAF | GO:0045838 | positive regulation of membrane potential | 2.26e-02 |
ARAF | GO:0048308 | organelle inheritance | 2.26e-02 |
ARAF | GO:0048313 | Golgi inheritance | 2.26e-02 |
ARAF | GO:0045579 | positive regulation of B cell differentiation | 2.26e-02 |
ARAF | GO:0047484 | regulation of response to osmotic stress | 2.26e-02 |
ARAF | GO:1903358 | regulation of Golgi organization | 2.26e-02 |
ARAF | GO:0046931 | pore complex assembly | 2.26e-02 |
ARAF | GO:0060438 | trachea development | 2.26e-02 |
ARAF | GO:2000641 | regulation of early endosome to late endosome transport | 2.26e-02 |
ARAF | GO:0009135 | purine nucleoside diphosphate metabolic process | 2.26e-02 |
ARAF | GO:0009179 | purine ribonucleoside diphosphate metabolic process | 2.26e-02 |
ARAF | GO:0003323 | type B pancreatic cell development | 2.35e-02 |
ARAF | GO:0090200 | positive regulation of release of cytochrome c from mitochondria | 2.35e-02 |
ARAF | GO:0021697 | cerebellar cortex formation | 2.35e-02 |
ARAF | GO:0006007 | glucose catabolic process | 2.35e-02 |
ARAF | GO:0003309 | type B pancreatic cell differentiation | 2.35e-02 |
ARAF | GO:0009185 | ribonucleoside diphosphate metabolic process | 2.35e-02 |
ARAF | GO:0035774 | positive regulation of insulin secretion involved in cellular response to glucose stimulus | 2.35e-02 |
ARAF | GO:0048679 | regulation of axon regeneration | 2.35e-02 |
ARAF | GO:0030878 | thyroid gland development | 2.35e-02 |
ARAF | GO:0060674 | placenta blood vessel development | 2.35e-02 |
ARAF | GO:0070570 | regulation of neuron projection regeneration | 2.35e-02 |
ARAF | GO:1903649 | regulation of cytoplasmic transport | 2.35e-02 |
ARAF | GO:0045577 | regulation of B cell differentiation | 2.35e-02 |
ARAF | GO:0002068 | glandular epithelial cell development | 2.35e-02 |
ARAF | GO:0021696 | cerebellar cortex morphogenesis | 2.35e-02 |
ARAF | GO:0009132 | nucleoside diphosphate metabolic process | 2.35e-02 |
ARAF | GO:0035883 | enteroendocrine cell differentiation | 2.35e-02 |
ARAF | GO:0019320 | hexose catabolic process | 2.35e-02 |
ARAF | GO:0021587 | cerebellum morphogenesis | 2.35e-02 |
ARAF | GO:0045022 | early endosome to late endosome transport | 2.35e-02 |
ARAF | GO:0060428 | lung epithelium development | 2.35e-02 |
ARAF | GO:0090199 | regulation of release of cytochrome c from mitochondria | 2.35e-02 |
ARAF | GO:0031018 | endocrine pancreas development | 2.35e-02 |
ARAF | GO:0060711 | labyrinthine layer development | 2.35e-02 |
ARAF | GO:0021575 | hindbrain morphogenesis | 2.35e-02 |
Top |
Related Drugs to TAF1C_ARAF |
Drugs used for this fusion-positive patient. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Drug | Source | PMID |
Distribution of the number of studies mentioning TAF1C-ARAF and kinase inhibitors the PubMed Abstract (04-01-2024) |
Fusion gene - drug pair 1 | Fusion gene - drug pair 2 | PMID | Publication date | DOI | Study title |
Top |
Related Diseases to TAF1C_ARAF |
Diseases that have this fusion gene. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Disease | Source | PMID |
Related diseases from the literature mentioned this fusion gene and drug. (PubMed, 04-01-2024) |
MeSH ID | MeSH term |
Diseases associated with fusion partners. (DisGeNet 4.0) |
Partner | Gene | Disease ID | Disease name | # pubmeds | Source |
Top |
Clinical Trials of the Found Drugs/Small Molecules |
Statistics of the Clinical Trials of the Found Kinase Inibitors from clinicaltrials.gov (06-17-2024) |
Clinical Trials from clinicaltrials.gov (06-17-2024) |
Fusion Gene | Kinase Inhibitor | NCT ID | Study Status | Phases | Disease | # Enrolment | Date |