UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
|
Kinase Fusion Gene:TGDS_DAPK1 |
Kinase Fusion Protein Summary |
Kinase Fusion gene summary |
Kinase Fusion partner gene information | Kinase Fusion gene name: TGDS_DAPK1 | KinaseFusionDB ID: KFG6508 | FusionGDB2.0 ID: KFG6508 | Hgene | Tgene | Gene symbol | TGDS | DAPK1 | Gene ID | 23483 | 1612 | |
Gene name | TDP-glucose 4,6-dehydratase | death associated protein kinase 1 | ||||||||||
Synonyms | CATMANS|SDR2E1|TDPGD | DAPK|ROCO3 | ||||||||||
Cytomap | 13q32.1 | 9q21.33 | ||||||||||
Type of gene | protein-coding | protein-coding | ||||||||||
Description | dTDP-D-glucose 4,6-dehydratasegrowth-inhibiting protein 21short chain dehydrogenase/reductase family 2E, member 1 | death-associated protein kinase 1DAP kinase 1 | ||||||||||
Modification date | 20240411 | 20240407 | ||||||||||
UniProtAcc | O95455 | P53355 | ||||||||||
Ensembl transtripts involved in fusion gene | ENST ids | ENST00000261296, ENST00000498294, | ENST00000466188, ENST00000358077, ENST00000408954, ENST00000469640, ENST00000472284, ENST00000491893, | |||||||||
Context (manual curation of fusion genes in KinaseFusionDB) | PubMed: TGDS [Title/Abstract] AND DAPK1 [Title/Abstract] AND fusion [Title/Abstract] | |||||||||||
Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) | TGDS(95248305)-DAPK1(90321047), # samples:2 |
Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
Partner | Gene | GO ID | GO term | PubMed ID |
Tgene | DAPK1 | GO:0002834 | regulation of response to tumor cell | 11573098 |
Tgene | DAPK1 | GO:0006468 | protein phosphorylation | 10629061 |
Tgene | DAPK1 | GO:0017148 | negative regulation of translation | 18995835 |
Tgene | DAPK1 | GO:0035556 | intracellular signal transduction | 10629061 |
Tgene | DAPK1 | GO:0043280 | positive regulation of cysteine-type endopeptidase activity involved in apoptotic process | 16132846 |
Tgene | DAPK1 | GO:0046777 | protein autophosphorylation | 10629061|12730201 |
Tgene | DAPK1 | GO:0071346 | cellular response to type II interferon | 18995835 |
Kinase Fusion gene breakpoints across TGDS (5'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Kinase Fusion gene breakpoints across DAPK1 (3'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Top |
Kinase Fusion Gene Sample Information |
Kinase Fusion gene information. |
Kinase Fusion gene information from four resources (ChiTars 5.0, ChimerDB 4.0, COSMIC, and CCLE) * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
Source | Sample | Hgene | Hchr | Hbp | Tgene | Tchr | Tbp |
ChimerDB4 | TCGA-AO-A0J2-01A | TGDS | chr13 | 95248305 | DAPK1 | chr9 | 90321047 |
Top |
Kinase Fusion ORF Analysis |
Kinase Fusion information from ORFfinder translation from full-length transcript sequence from KinaseFusionDB. |
Henst | Tenst | Hgene | Hchr | Hbp | Tgene | Tchr | Tbp | Seq length (transcript) | Seq length (amino acids) |
ENST00000261296 | ENST00000472284 | TGDS | chr13 | 95248305 | DAPK1 | chr9 | 90321047 | 2706 | 441 |
Top |
Kinase Fusion Amino Acid Sequences |
For individual full-length fusion transcript sequence from KinaseFusionDB, we ran ORFfinder and chose the longest ORF among the all predicted ones. |
>Henst_Tenst_Hgene_Hchr_Hbp_Tgene_Tchr_Tbp_length(fusion AA)_AAseq >ENST00000261296_ENST00000472284_TGDS_chr13_95248305_DAPK1_chr9_90321047_length(amino acids)=441 MGDVGGVLGGTVGSSRRLCEAGPGDRRCWFHINIMQSETVQDVLLLDPRWLCTNVLGKLLSVETPRALHHYRGRYTVEDIQRLVPDSDVE ELLQILDAMDICARDLSSGTMVDVPALIKTDNLHRSWADEEDEVMVYGGVRIVPVEHLTPFPCGIFHKVQVNLCRWIHQQSTEGDADIRL WVNGCKLANRGAELLVLLVNHGQGIEVQVRGLETEKIKCCLLLDSVCSTIENVMATTLPGLLTVKHYLSPQQLREHHEPVMIYQPRDFFR AQTLKETSLTNTMGGYKESFSSIMCFGCHDVYSQASLGMDIHASDLNLLTRRKLSRLLDPPDPLGKDWCLLAMNLGLPDLVAKYNTSNGA -------------------------------------------------------------- |
Multiple Sequence Alignment of All Fusion Protein Isoforms |
Top |
Kinase Fusion Protein Functional Features |
Four levels of functional features of fusion genes Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr13:95248305/chr9:90321047) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
Main function of each fusion partner protein. (from UniProt) |
Hgene | Tgene |
TGDS | DAPK1 |
FUNCTION: Calcium/calmodulin-dependent serine/threonine kinase involved in multiple cellular signaling pathways that trigger cell survival, apoptosis, and autophagy. Regulates both type I apoptotic and type II autophagic cell deaths signal, depending on the cellular setting. The former is caspase-dependent, while the latter is caspase-independent and is characterized by the accumulation of autophagic vesicles. Phosphorylates PIN1 resulting in inhibition of its catalytic activity, nuclear localization, and cellular function. Phosphorylates TPM1, enhancing stress fiber formation in endothelial cells. Phosphorylates STX1A and significantly decreases its binding to STXBP1. Phosphorylates PRKD1 and regulates JNK signaling by binding and activating PRKD1 under oxidative stress. Phosphorylates BECN1, reducing its interaction with BCL2 and BCL2L1 and promoting the induction of autophagy. Phosphorylates TSC2, disrupting the TSC1-TSC2 complex and stimulating mTORC1 activity in a growth factor-dependent pathway. Phosphorylates RPS6, MYL9 and DAPK3. Acts as a signaling amplifier of NMDA receptors at extrasynaptic sites for mediating brain damage in stroke. Cerebral ischemia recruits DAPK1 into the NMDA receptor complex and it phosphorylates GRINB at Ser-1303 inducing injurious Ca(2+) influx through NMDA receptor channels, resulting in an irreversible neuronal death. Required together with DAPK3 for phosphorylation of RPL13A upon interferon-gamma activation which is causing RPL13A involvement in transcript-selective translation inhibition.; FUNCTION: Isoform 2 cannot induce apoptosis but can induce membrane blebbing. |
Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
- Retained domain in the 5'-partner of fusion protein (protein functional feature from UniProt). |
Partner | Hgeneene | Hbp | Tgeneene | Tbp | ENST | BPexon | TotalExon | Protein feature loci | BPloci | TotalLen | Feature | Note |
- Retained domain in the 3'-partner of fusion protein (protein functional feature from UniProt). |
Partner | Hgeneene | Hbp | Tgeneene | Tbp | ENST | BPexon | TotalExon | Protein feature loci | BPloci | TotalLen | Feature | Note |
Tgene | TGDS | 95248305 | DAPK1 | 90321047 | ENST00000261296 | 24 | 26 | 1312_1396 | 1020 | 1431 | Domain | Note=Death;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00064 |
Top |
Kinase Fusion Protein Structures |
CIF files of the predicted kinase fusion proteins * Here we show the 3D structure of the fusion proteins using Mol*. AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Model confidence is shown from the pLDDT values per residue. pLDDT corresponds to the model’s prediction of its score on the local Distance Difference Test. It is a measure of local accuracy (from AlphfaFold website). To color code individual residues, we transformed individual PDB files into CIF format. |
Kinase Fusion protein CIF link (fusion AA seq ID in KinaseFusionDB) | Henst | Tenst | Hgene | Hchr | Hbp | Tgene | Tchr | Tbp | AA seq | Len(AA seq) |
PDB file >>>502_TGDS_DAPK1 | ENST00000261296 | ENST00000472284 | TGDS | chr13 | 95248305 | DAPK1 | chr9 | 90321047 | MGDVGGVLGGTVGSSRRLCEAGPGDRRCWFHINIMQSETVQDVLLLDPRWLCTNVLGKLLSVETPRALHHYRGRYTVEDIQRLVPDSDVE ELLQILDAMDICARDLSSGTMVDVPALIKTDNLHRSWADEEDEVMVYGGVRIVPVEHLTPFPCGIFHKVQVNLCRWIHQQSTEGDADIRL WVNGCKLANRGAELLVLLVNHGQGIEVQVRGLETEKIKCCLLLDSVCSTIENVMATTLPGLLTVKHYLSPQQLREHHEPVMIYQPRDFFR AQTLKETSLTNTMGGYKESFSSIMCFGCHDVYSQASLGMDIHASDLNLLTRRKLSRLLDPPDPLGKDWCLLAMNLGLPDLVAKYNTSNGA | 441 |
3D view using mol* of 502_TGDS_DAPK1 | ||||||||||
PDB file >>>TKFP_853_TGDS_DAPK1 | ENST00000261296 | ENST00000472284 | TGDS | chr13 | 95248305 | DAPK1 | chr9 | 90321047 | MGDVGGVLGGTVGSSRRLCEAGPGDRRCWFHINIMQSETVQDVLLLDPRWLCTNVLGKLLSVETPRALHHYRGRYTVEDIQRLVPDSDVE ELLQILDAMDICARDLSSGTMVDVPALIKTDNLHRSWADEEDEVMVYGGVRIVPVEHLTPFPCGIFHKVQVNLCRWIHQQSTEGDADIRL WVNGCKLANRGAELLVLLVNHGQGIEVQVRGLETEKIKCCLLLDSVCSTIENVMATTLPGLLTVKHYLSPQQLREHHEPVMIYQPRDFFR AQTLKETSLTNTMGGYKESFSSIMCFGCHDVYSQASLGMDIHASDLNLLTRRKLSRLLDPPDPLGKDWCLLAMNLGLPDLVAKYNTSNGA | 441_TGDS_DAPK1 |
Top |
Comparison of Fusion Protein Isoforms |
Superimpose the 3D Structures Among All Fusion Protein Isoforms * Download the pdb file and open it from the molstar online viewer. |
Comparison of the Secondary Structures of Fusion Protein Isoforms |
Top |
Comparison of Fusion Protein Sequences/Structures with Known Sequences/Structures from PDB |
Top |
pLDDT score distribution |
pLDDT score distribution of the predicted fusion protein structures from AlphaFold2 * AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. * The blue color at the bottom marks the best active site residues. |
502_TGDS_DAPK1.png |
502_TGDS_DAPK1.png |
Top |
Potential Active Site Information |
The potential binding sites of these fusion proteins were identified using SiteMap, a module of the Schrodinger suite. |
Kinase Fusion AA seq ID in KinaseFusionDB | Site score | Size | Dscore | Volume | Exposure | Enclosure | Contact | Phobic | Philic | Balance | Don/Acc | Residues |
Top |
Ramachandran Plot of Kinase Fusion Protein Structure |
Ramachandran plot of the torsional angles - phi (φ)and psi (ψ) - of the residues (amino acids) contained in this fusion protein peptide. |
502_TGDS_DAPK1_ramachandran.png |
Top |
Virtual Screening Results |
Distribution of the average docking score across all approved kinase inhibitors. Distribution of the number of occurrence across all approved kinase inhibitors. |
5'-kinase fusion protein case |
3'-kinase fusion protein case |
Top |
Drug information from DrugBank of the top 20 interacting small molecules. * The detailed information of individual kinase inhibitors are available in the download page. |
Fusion gene name info | Drug | Docking score | Glide g score | Glide energy |
502_TGDS_DAPK1-DOCK_HTVS_1-001 | Baricitinib | -6.461069999999999 | -6.461069999999999 | -45.1887 |
502_TGDS_DAPK1-DOCK_HTVS_1-001 | Lapatinib | -6.2504800000000005 | -6.3392800000000005 | -46.8127 |
502_TGDS_DAPK1-DOCK_HTVS_1-001 | Ruxolitinib | -6.036580000000001 | -6.036580000000001 | -39.6421 |
502_TGDS_DAPK1-DOCK_HTVS_1-001 | Lapatinib | -6.01757 | -6.10637 | -45.6478 |
502_TGDS_DAPK1-DOCK_HTVS_1-001 | Tepotinib | -6.0034 | -6.0045 | -51.5637 |
502_TGDS_DAPK1-DOCK_HTVS_1-001 | Tepotinib | -5.92244 | -5.92354 | -50.4399 |
502_TGDS_DAPK1-DOCK_HTVS_1-001 | Zanubrutinib | -5.8371699999999995 | -5.8371699999999995 | -48.0434 |
502_TGDS_DAPK1-DOCK_HTVS_1-001 | Axitinib | -5.74314 | -5.74634 | -37.0079 |
502_TGDS_DAPK1-DOCK_HTVS_1-001 | Acalabrutinib | -5.6883 | -5.7024 | -47.4661 |
502_TGDS_DAPK1-DOCK_HTVS_1-001 | Acalabrutinib | -5.6883 | -5.7024 | -47.4661 |
502_TGDS_DAPK1-DOCK_HTVS_1-001 | Ruxolitinib | -5.51932 | -5.51932 | -36.4491 |
502_TGDS_DAPK1-DOCK_HTVS_1-001 | Nilotinib | -5.5021 | -6.4269 | -52.7368 |
502_TGDS_DAPK1-DOCK_HTVS_1-001 | Nilotinib | -5.5021 | -6.4269 | -52.7368 |
502_TGDS_DAPK1-DOCK_HTVS_1-001 | Cobimetinib | -5.49331 | -5.49611 | -39.4455 |
502_TGDS_DAPK1-DOCK_HTVS_1-001 | Tepotinib | -5.36555 | -5.36665 | -46.1877 |
502_TGDS_DAPK1-DOCK_HTVS_1-001 | Neratinib | -5.3522300000000005 | -5.538130000000001 | -51.0049 |
502_TGDS_DAPK1-DOCK_HTVS_1-001 | Fedratinib | -5.3401 | -5.3915 | -48.6126 |
502_TGDS_DAPK1-DOCK_HTVS_1-001 | Fedratinib | -5.3401 | -5.3915 | -48.6126 |
502_TGDS_DAPK1-DOCK_HTVS_1-001 | Larotrectinib | -5.30766 | -5.30766 | -45.5445 |
502_TGDS_DAPK1-DOCK_HTVS_1-001 | Entrectinib | -5.20924 | -5.2739400000000005 | -41.7802 |
Top |
Kinase-Substrate Information of TGDS_DAPK1 |
Phosphorylation target of the kinase (phosphosite, 03-17-2024) |
Kinase | Kinase UniProt Acc | Kinase species | Substrate | Substrate UniProt Acc | Substrate phosphorylated residues | Substrate phosphorylated sites (+/-7AA) | Domain |
DAPK1 | P53355 | human | RIGI | O95786 | S654 | IEGNPkLsFLkPGIL | Helicase_C |
DAPK1 | P53355 | human | CAMKK2 | Q96RR4 | S511 | RREERsLsAPGNLLT | |
DAPK1 | P53355 | human | HSF1 | Q00613 | S230 | PkYSRQFsLEHVHGS | |
DAPK1 | P53355 | human | TP53 | P04637 | T18 | EPPLsQEtFsDLWkL | P53_TAD |
DAPK1 | P53355 | human | PIN1 | Q13526 | S71 | HsQSRRPssWRQEKI | Rotamase |
DAPK1 | P53355 | human | DAPK1 | P53355 | S289 | QALSRKAsAVNMEkF | |
DAPK1 | P53355 | human | RIGI | O95786 | T671 | RGktNQNtGMtLPAQ | Helicase_C |
DAPK1 | P53355 | human | TP53 | P04637 | S269 | GNLLGRNsFEVRVCA | P53 |
DAPK1 | P53355 | human | TPM1 | P09493 | S283 | HALNDMtsI______ | Tropomyosin |
DAPK1 | P53355 | human | GRIN2B | Q13224 | S1303 | NKLRRQHsyDtFVDL | NMDAR2_C |
DAPK1 | P53355 | human | RIGI | O95786 | S764 | kEkMMNDsILRLQtW | |
DAPK1 | P53355 | human | DAPK1 | P53355 | S308 | ARKKWkQsVRLISLC | |
DAPK1 | P53355 | human | RIGI | O95786 | T770 | DsILRLQtWDEAVFR | |
DAPK1 | P53355 | human | RPL13A | P40429 | S77 | PYHFrAPsRIFWRTV | Ribosomal_L13 |
DAPK1 | P53355 | human | MYL12B | O14950 | S20 | KRPQRAtsNVFAMFD | |
DAPK1 | P53355 | human | RIGI | O95786 | S8 | MTTEQRRsLQAFQDY | CARD_2 |
DAPK1 | P53355 | human | BECN1 | Q14457 | T119 | LSRRLkVtGDLFDIM | BH3 |
DAPK1 | P53355 | human | TP53 | P04637 | S20 | PLsQEtFsDLWkLLP | P53_TAD |
DAPK1 | P53355 | human | RIGI | O95786 | T674 | tNQNtGMtLPAQkCI | Helicase_C |
DAPK1 | P53355 | human | MYL9 | P24844 | S20 | KRPQRAtsNVFAMFD | |
DAPK1 | P53355 | human | MCM3 | P25205 | S160 | KtIERRysDLttLVA | MCM_OB |
DAPK1 | P53355 | human | PELI1 | Q96FA3 | S39 | GDRGRRKsRFALFKR | Pellino |
DAPK1 | P53355 | human | RIGI | O95786 | T667 | ILTGRGktNQNtGMt | Helicase_C |
Biological Network Integration of This Kinase and Substrates (GeneMANIA website) |
Enriched GO biological processes of the phosphorylation target genes of the kinase |
Kinase | GOID | GO term | P.adjust |
DAPK1 | ID | Description | 0.00e+00 |
DAPK1 | GO:0034599 | cellular response to oxidative stress | 1.47e-05 |
DAPK1 | GO:0062197 | cellular response to chemical stress | 2.68e-05 |
DAPK1 | GO:0006979 | response to oxidative stress | 7.07e-05 |
DAPK1 | GO:0034614 | cellular response to reactive oxygen species | 9.35e-04 |
DAPK1 | GO:0000302 | response to reactive oxygen species | 2.32e-03 |
DAPK1 | GO:0000422 | autophagy of mitochondrion | 6.28e-03 |
DAPK1 | GO:0061726 | mitochondrion disassembly | 6.28e-03 |
DAPK1 | GO:0001666 | response to hypoxia | 6.28e-03 |
DAPK1 | GO:0036293 | response to decreased oxygen levels | 6.93e-03 |
DAPK1 | GO:0071346 | cellular response to type II interferon | 7.89e-03 |
DAPK1 | GO:0070482 | response to oxygen levels | 7.89e-03 |
DAPK1 | GO:0010506 | regulation of autophagy | 8.26e-03 |
DAPK1 | GO:0034341 | response to type II interferon | 9.20e-03 |
DAPK1 | GO:1903008 | organelle disassembly | 9.20e-03 |
DAPK1 | GO:0031331 | positive regulation of cellular catabolic process | 9.20e-03 |
DAPK1 | GO:0071280 | cellular response to copper ion | 9.20e-03 |
DAPK1 | GO:0010508 | positive regulation of autophagy | 9.20e-03 |
DAPK1 | GO:0071480 | cellular response to gamma radiation | 9.20e-03 |
DAPK1 | GO:0016242 | negative regulation of macroautophagy | 1.23e-02 |
DAPK1 | GO:0046688 | response to copper ion | 1.53e-02 |
DAPK1 | GO:0000423 | mitophagy | 1.53e-02 |
DAPK1 | GO:0022411 | cellular component disassembly | 1.53e-02 |
DAPK1 | GO:0062098 | regulation of programmed necrotic cell death | 1.53e-02 |
DAPK1 | GO:1903146 | regulation of autophagy of mitochondrion | 1.53e-02 |
DAPK1 | GO:0070266 | necroptotic process | 2.04e-02 |
DAPK1 | GO:2000378 | negative regulation of reactive oxygen species metabolic process | 2.04e-02 |
DAPK1 | GO:0010665 | regulation of cardiac muscle cell apoptotic process | 2.04e-02 |
DAPK1 | GO:0042149 | cellular response to glucose starvation | 2.04e-02 |
DAPK1 | GO:0010332 | response to gamma radiation | 2.05e-02 |
DAPK1 | GO:0010662 | regulation of striated muscle cell apoptotic process | 2.06e-02 |
DAPK1 | GO:0010659 | cardiac muscle cell apoptotic process | 2.11e-02 |
DAPK1 | GO:0090257 | regulation of muscle system process | 2.11e-02 |
DAPK1 | GO:0010658 | striated muscle cell apoptotic process | 2.18e-02 |
DAPK1 | GO:0043331 | response to dsRNA | 2.19e-02 |
DAPK1 | GO:0097300 | programmed necrotic cell death | 2.35e-02 |
DAPK1 | GO:0043462 | regulation of ATP-dependent activity | 2.53e-02 |
DAPK1 | GO:2001244 | positive regulation of intrinsic apoptotic signaling pathway | 2.53e-02 |
DAPK1 | GO:0050435 | amyloid-beta metabolic process | 2.54e-02 |
DAPK1 | GO:0070301 | cellular response to hydrogen peroxide | 2.63e-02 |
DAPK1 | GO:0071479 | cellular response to ionizing radiation | 2.80e-02 |
DAPK1 | GO:0030239 | myofibril assembly | 2.81e-02 |
DAPK1 | GO:0055002 | striated muscle cell development | 2.90e-02 |
DAPK1 | GO:0006302 | double-strand break repair | 2.92e-02 |
DAPK1 | GO:0010822 | positive regulation of mitochondrion organization | 2.92e-02 |
DAPK1 | GO:0010660 | regulation of muscle cell apoptotic process | 3.54e-02 |
DAPK1 | GO:0034249 | negative regulation of amide metabolic process | 3.54e-02 |
DAPK1 | GO:0097194 | execution phase of apoptosis | 3.54e-02 |
DAPK1 | GO:0032496 | response to lipopolysaccharide | 3.54e-02 |
DAPK1 | GO:0009895 | negative regulation of catabolic process | 3.54e-02 |
Top |
Related Drugs to TGDS_DAPK1 |
Drugs used for this fusion-positive patient. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Drug | Source | PMID |
Distribution of the number of studies mentioning TGDS-DAPK1 and kinase inhibitors the PubMed Abstract (04-01-2024) |
Fusion gene - drug pair 1 | Fusion gene - drug pair 2 | PMID | Publication date | DOI | Study title |
Top |
Related Diseases to TGDS_DAPK1 |
Diseases that have this fusion gene. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Disease | Source | PMID |
Related diseases from the literature mentioned this fusion gene and drug. (PubMed, 04-01-2024) |
MeSH ID | MeSH term |
Diseases associated with fusion partners. (DisGeNet 4.0) |
Partner | Gene | Disease ID | Disease name | # pubmeds | Source |
Top |
Clinical Trials of the Found Drugs/Small Molecules |
Statistics of the Clinical Trials of the Found Kinase Inibitors from clinicaltrials.gov (06-17-2024) |
Clinical Trials from clinicaltrials.gov (06-17-2024) |
Fusion Gene | Kinase Inhibitor | NCT ID | Study Status | Phases | Disease | # Enrolment | Date |