UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
|
Kinase Fusion Gene:TNIK_DPPA2 |
Kinase Fusion Protein Summary |
Kinase Fusion gene summary |
Kinase Fusion partner gene information | Kinase Fusion gene name: TNIK_DPPA2 | KinaseFusionDB ID: KFG6645 | FusionGDB2.0 ID: KFG6645 | Hgene | Tgene | Gene symbol | TNIK | DPPA2 | Gene ID | 23043 | 151871 | |
Gene name | TRAF2 and NCK interacting kinase | developmental pluripotency associated 2 | ||||||||||
Synonyms | MRT54 | CT100|ECAT15-2|PESCRG1 | ||||||||||
Cytomap | 3q26.2-q26.31 | 3q13.13 | ||||||||||
Type of gene | protein-coding | protein-coding | ||||||||||
Description | TRAF2 and NCK-interacting protein kinase | developmental pluripotency-associated protein 2cancer/testis antigen 100embryonic stem cell (ESC) associated transcript 15-2pluripotent embryonic stem cell-related gene 1 protein | ||||||||||
Modification date | 20240407 | 20240305 | ||||||||||
UniProtAcc | Q9UKE5 | Q7Z7J5 | ||||||||||
Ensembl transtripts involved in fusion gene | ENST ids | ENST00000341852, ENST00000357327, ENST00000436636, ENST00000488470, ENST00000284483, ENST00000369326, ENST00000460047, ENST00000464785, ENST00000465393, ENST00000470834, ENST00000475336, ENST00000538048, | ENST00000478945, | |||||||||
Context (manual curation of fusion genes in KinaseFusionDB) | PubMed: TNIK [Title/Abstract] AND DPPA2 [Title/Abstract] AND fusion [Title/Abstract] | |||||||||||
Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) | TNIK(170824971)-DPPA2(109019282), # samples:1 TNIK(170824972)-DPPA2(109019282), # samples:1 |
Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
Partner | Gene | GO ID | GO term | PubMed ID |
Hgene | TNIK | GO:0006468 | protein phosphorylation | 10521462|15342639|22797597 |
Hgene | TNIK | GO:0030036 | actin cytoskeleton organization | 15342639 |
Hgene | TNIK | GO:0035556 | intracellular signal transduction | 10521462 |
Hgene | TNIK | GO:0046330 | positive regulation of JNK cascade | 15342639 |
Hgene | TNIK | GO:0046777 | protein autophosphorylation | 10521462|15342639 |
Hgene | TNIK | GO:0048814 | regulation of dendrite morphogenesis | 20159449 |
Kinase Fusion gene breakpoints across TNIK (5'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Kinase Fusion gene breakpoints across DPPA2 (3'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Top |
Kinase Fusion Gene Sample Information |
Kinase Fusion gene information. |
Kinase Fusion gene information from four resources (ChiTars 5.0, ChimerDB 4.0, COSMIC, and CCLE) * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
Source | Sample | Hgene | Hchr | Hbp | Tgene | Tchr | Tbp |
ChimerDB4 | TCGA-BR-A4PE-01A | TNIK | chr3 | 170824972 | DPPA2 | chr3 | 109019282 |
ChimerDB4 | TCGA-BR-A4PE | TNIK | chr3 | 170824971 | DPPA2 | chr3 | 109019282 |
Top |
Kinase Fusion ORF Analysis |
Kinase Fusion information from ORFfinder translation from full-length transcript sequence from KinaseFusionDB. |
Henst | Tenst | Hgene | Hchr | Hbp | Tgene | Tchr | Tbp | Seq length (transcript) | Seq length (amino acids) |
ENST00000436636 | ENST00000478945 | TNIK | chr3 | 170824971 | DPPA2 | chr3 | 109019282 | 3033 | 813 |
ENST00000436636 | ENST00000478945 | TNIK | chr3 | 170824972 | DPPA2 | chr3 | 109019282 | 3033 | 813 |
Top |
Kinase Fusion Amino Acid Sequences |
For individual full-length fusion transcript sequence from KinaseFusionDB, we ran ORFfinder and chose the longest ORF among the all predicted ones. |
>Henst_Tenst_Hgene_Hchr_Hbp_Tgene_Tchr_Tbp_length(fusion AA)_AAseq >ENST00000436636_ENST00000478945_TNIK_chr3_170824971_DPPA2_chr3_109019282_length(amino acids)=813 MVHFSSEEVDMASDSPARSLDEIDLSALRDPAGIFELVELVGNGTYGQVYKGRHVKTGQLAAIKVMDVTGDEEEEIKQEINMLKKYSHHR NIATYYGAFIKKNPPGMDDQLWLVMEFCGAGSVTDLIKNTKGNTLKEEWIAYICREILRGLSHLHQHKVIHRDIKGQNVLLTENAEVKLV DFGVSAQLDRTVGRRNTFIGTPYWMAPEVIACDENPDATYDFKSDLWSLGITAIEMAEGAPPLCDMHPMRALFLIPRNPAPRLKSKKWSK KFQSFIESCLVKNHSQRPATEQLMKHPFIRDQPNERQVRIQLKDHIDRTKKKRGEKDETEYEYSGSEEEEEENDSGEPSSILNLPGESTL RRDFLRLQLANKERSEALRRQQLEQQQRENEEHKRQLLAERQKRIEEQKEQRRRLEEQQRREKELRKQQEREQRRHYEEQMRREEERRRA EHEQEYIRRQLEEEQRQLEILQQQLLHEQALLLEYKRKQLEEQRQAERLQRQLKQERDYLVSLQHQRQEQRPVEKKPLYHYKEGMSPSEK PAWAKEVEERSRLNRQSSPAMPHKVANRISDPNLPPRSESFSISGVQPARTPPMLRPVDPQIPHLVAVKSQGPALTASQSVHEQPTKGLS GFQEALNVTSHRVEMPRQNSDPTSENPPLPTRIEKFDRSSWLRQEEDIPPKVPQRTTSISPALARKNSPGNGSALGPRLGSQPIRASNPD LRRTEPILESPLQRTSSGSSSSSSTPSSQPSSQGGSQPGSQAGSSERTRVRANSKSEGSPVLPHEPAKVKPEESRDITRPSRPASYKKAI -------------------------------------------------------------- >ENST00000436636_ENST00000478945_TNIK_chr3_170824972_DPPA2_chr3_109019282_length(amino acids)=813 MVHFSSEEVDMASDSPARSLDEIDLSALRDPAGIFELVELVGNGTYGQVYKGRHVKTGQLAAIKVMDVTGDEEEEIKQEINMLKKYSHHR NIATYYGAFIKKNPPGMDDQLWLVMEFCGAGSVTDLIKNTKGNTLKEEWIAYICREILRGLSHLHQHKVIHRDIKGQNVLLTENAEVKLV DFGVSAQLDRTVGRRNTFIGTPYWMAPEVIACDENPDATYDFKSDLWSLGITAIEMAEGAPPLCDMHPMRALFLIPRNPAPRLKSKKWSK KFQSFIESCLVKNHSQRPATEQLMKHPFIRDQPNERQVRIQLKDHIDRTKKKRGEKDETEYEYSGSEEEEEENDSGEPSSILNLPGESTL RRDFLRLQLANKERSEALRRQQLEQQQRENEEHKRQLLAERQKRIEEQKEQRRRLEEQQRREKELRKQQEREQRRHYEEQMRREEERRRA EHEQEYIRRQLEEEQRQLEILQQQLLHEQALLLEYKRKQLEEQRQAERLQRQLKQERDYLVSLQHQRQEQRPVEKKPLYHYKEGMSPSEK PAWAKEVEERSRLNRQSSPAMPHKVANRISDPNLPPRSESFSISGVQPARTPPMLRPVDPQIPHLVAVKSQGPALTASQSVHEQPTKGLS GFQEALNVTSHRVEMPRQNSDPTSENPPLPTRIEKFDRSSWLRQEEDIPPKVPQRTTSISPALARKNSPGNGSALGPRLGSQPIRASNPD LRRTEPILESPLQRTSSGSSSSSSTPSSQPSSQGGSQPGSQAGSSERTRVRANSKSEGSPVLPHEPAKVKPEESRDITRPSRPASYKKAI -------------------------------------------------------------- |
Multiple Sequence Alignment of All Fusion Protein Isoforms |
Top |
Kinase Fusion Protein Functional Features |
Four levels of functional features of fusion genes Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr3:170824971/chr3:109019282) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
Main function of each fusion partner protein. (from UniProt) |
Hgene | Tgene |
TNIK | DPPA2 |
FUNCTION: Serine/threonine kinase that acts as an essential activator of the Wnt signaling pathway. Recruited to promoters of Wnt target genes and required to activate their expression. May act by phosphorylating TCF4/TCF7L2. Appears to act upstream of the JUN N-terminal pathway. May play a role in the response to environmental stress. Part of a signaling complex composed of NEDD4, RAP2A and TNIK which regulates neuronal dendrite extension and arborization during development. More generally, it may play a role in cytoskeletal rearrangements and regulate cell spreading. Phosphorylates SMAD1 on Thr-322. {ECO:0000269|PubMed:10521462, ECO:0000269|PubMed:15342639, ECO:0000269|PubMed:19061864, ECO:0000269|PubMed:19816403, ECO:0000269|PubMed:20159449, ECO:0000269|PubMed:21690388}. | FUNCTION: Binds to target gene promoters, including NKX2-5 and SYCE1, but not GATA4, and may be involved in the maintenance of the active epigenetic status of these genes. {ECO:0000250}. |
Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
- Retained domain in the 5'-partner of fusion protein (protein functional feature from UniProt). |
Partner | Hgeneene | Hbp | Tgeneene | Tbp | ENST | BPexon | TotalExon | Protein feature loci | BPloci | TotalLen | Feature | Note |
Hgene | TNIK | 170824971 | DPPA2 | 109019282 | ENST00000436636 | 19 | 31 | 25_289 | 7181 | 1277 | Domain | Note=Protein kinase;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00159 |
Hgene | TNIK | 170824971 | DPPA2 | 109019282 | ENST00000436636 | 20 | 32 | 25_289 | 7471 | 1306 | Domain | Note=Protein kinase;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00159 |
Hgene | TNIK | 170824971 | DPPA2 | 109019282 | ENST00000436636 | 20 | 32 | 25_289 | 7731 | 1332 | Domain | Note=Protein kinase;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00159 |
Hgene | TNIK | 170824971 | DPPA2 | 109019282 | ENST00000436636 | 21 | 33 | 25_289 | 8021 | 1361 | Domain | Note=Protein kinase;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00159 |
Hgene | TNIK | 170824972 | DPPA2 | 109019282 | ENST00000436636 | 19 | 31 | 25_289 | 7181 | 1277 | Domain | Note=Protein kinase;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00159 |
Hgene | TNIK | 170824972 | DPPA2 | 109019282 | ENST00000436636 | 20 | 32 | 25_289 | 7471 | 1306 | Domain | Note=Protein kinase;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00159 |
Hgene | TNIK | 170824972 | DPPA2 | 109019282 | ENST00000436636 | 20 | 32 | 25_289 | 7731 | 1332 | Domain | Note=Protein kinase;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00159 |
Hgene | TNIK | 170824972 | DPPA2 | 109019282 | ENST00000436636 | 21 | 33 | 25_289 | 8021 | 1361 | Domain | Note=Protein kinase;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00159 |
- Retained domain in the 3'-partner of fusion protein (protein functional feature from UniProt). |
Partner | Hgeneene | Hbp | Tgeneene | Tbp | ENST | BPexon | TotalExon | Protein feature loci | BPloci | TotalLen | Feature | Note |
Top |
Kinase Fusion Protein Structures |
CIF files of the predicted kinase fusion proteins * Here we show the 3D structure of the fusion proteins using Mol*. AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Model confidence is shown from the pLDDT values per residue. pLDDT corresponds to the model’s prediction of its score on the local Distance Difference Test. It is a measure of local accuracy (from AlphfaFold website). To color code individual residues, we transformed individual PDB files into CIF format. |
Kinase Fusion protein CIF link (fusion AA seq ID in KinaseFusionDB) | Henst | Tenst | Hgene | Hchr | Hbp | Tgene | Tchr | Tbp | AA seq | Len(AA seq) |
PDB file >>>282_TNIK_DPPA2 | ENST00000436636 | ENST00000478945 | TNIK | chr3 | 170824972 | DPPA2 | chr3 | 109019282 | MVHFSSEEVDMASDSPARSLDEIDLSALRDPAGIFELVELVGNGTYGQVYKGRHVKTGQLAAIKVMDVTGDEEEEIKQEINMLKKYSHHR NIATYYGAFIKKNPPGMDDQLWLVMEFCGAGSVTDLIKNTKGNTLKEEWIAYICREILRGLSHLHQHKVIHRDIKGQNVLLTENAEVKLV DFGVSAQLDRTVGRRNTFIGTPYWMAPEVIACDENPDATYDFKSDLWSLGITAIEMAEGAPPLCDMHPMRALFLIPRNPAPRLKSKKWSK KFQSFIESCLVKNHSQRPATEQLMKHPFIRDQPNERQVRIQLKDHIDRTKKKRGEKDETEYEYSGSEEEEEENDSGEPSSILNLPGESTL RRDFLRLQLANKERSEALRRQQLEQQQRENEEHKRQLLAERQKRIEEQKEQRRRLEEQQRREKELRKQQEREQRRHYEEQMRREEERRRA EHEQEYIRRQLEEEQRQLEILQQQLLHEQALLLEYKRKQLEEQRQAERLQRQLKQERDYLVSLQHQRQEQRPVEKKPLYHYKEGMSPSEK PAWAKEVEERSRLNRQSSPAMPHKVANRISDPNLPPRSESFSISGVQPARTPPMLRPVDPQIPHLVAVKSQGPALTASQSVHEQPTKGLS GFQEALNVTSHRVEMPRQNSDPTSENPPLPTRIEKFDRSSWLRQEEDIPPKVPQRTTSISPALARKNSPGNGSALGPRLGSQPIRASNPD LRRTEPILESPLQRTSSGSSSSSSTPSSQPSSQGGSQPGSQAGSSERTRVRANSKSEGSPVLPHEPAKVKPEESRDITRPSRPASYKKAI | 813 |
3D view using mol* of 282_TNIK_DPPA2 | ||||||||||
PDB file >>>HKFP_408_TNIK_DPPA2 | ENST00000436636 | ENST00000478945 | TNIK | chr3 | 170824971 | DPPA2 | chr3 | 109019282 | MVHFSSEEVDMASDSPARSLDEIDLSALRDPAGIFELVELVGNGTYGQVYKGRHVKTGQLAAIKVMDVTGDEEEEIKQEINMLKKYSHHR NIATYYGAFIKKNPPGMDDQLWLVMEFCGAGSVTDLIKNTKGNTLKEEWIAYICREILRGLSHLHQHKVIHRDIKGQNVLLTENAEVKLV DFGVSAQLDRTVGRRNTFIGTPYWMAPEVIACDENPDATYDFKSDLWSLGITAIEMAEGAPPLCDMHPMRALFLIPRNPAPRLKSKKWSK KFQSFIESCLVKNHSQRPATEQLMKHPFIRDQPNERQVRIQLKDHIDRTKKKRGEKDETEYEYSGSEEEEEENDSGEPSSILNLPGESTL RRDFLRLQLANKERSEALRRQQLEQQQRENEEHKRQLLAERQKRIEEQKEQRRRLEEQQRREKELRKQQEREQRRHYEEQMRREEERRRA EHEQEYIRRQLEEEQRQLEILQQQLLHEQALLLEYKRKQLEEQRQAERLQRQLKQERDYLVSLQHQRQEQRPVEKKPLYHYKEGMSPSEK PAWAKEVEERSRLNRQSSPAMPHKVANRISDPNLPPRSESFSISGVQPARTPPMLRPVDPQIPHLVAVKSQGPALTASQSVHEQPTKGLS GFQEALNVTSHRVEMPRQNSDPTSENPPLPTRIEKFDRSSWLRQEEDIPPKVPQRTTSISPALARKNSPGNGSALGPRLGSQPIRASNPD LRRTEPILESPLQRTSSGSSSSSSTPSSQPSSQGGSQPGSQAGSSERTRVRANSKSEGSPVLPHEPAKVKPEESRDITRPSRPASYKKAI | 813_TNIK_DPPA2 |
PDB file >>>HKFP_409_TNIK_DPPA2 | ENST00000436636 | ENST00000478945 | TNIK | chr3 | 170824972 | DPPA2 | chr3 | 109019282 | MVHFSSEEVDMASDSPARSLDEIDLSALRDPAGIFELVELVGNGTYGQVYKGRHVKTGQLAAIKVMDVTGDEEEEIKQEINMLKKYSHHR NIATYYGAFIKKNPPGMDDQLWLVMEFCGAGSVTDLIKNTKGNTLKEEWIAYICREILRGLSHLHQHKVIHRDIKGQNVLLTENAEVKLV DFGVSAQLDRTVGRRNTFIGTPYWMAPEVIACDENPDATYDFKSDLWSLGITAIEMAEGAPPLCDMHPMRALFLIPRNPAPRLKSKKWSK KFQSFIESCLVKNHSQRPATEQLMKHPFIRDQPNERQVRIQLKDHIDRTKKKRGEKDETEYEYSGSEEEEEENDSGEPSSILNLPGESTL RRDFLRLQLANKERSEALRRQQLEQQQRENEEHKRQLLAERQKRIEEQKEQRRRLEEQQRREKELRKQQEREQRRHYEEQMRREEERRRA EHEQEYIRRQLEEEQRQLEILQQQLLHEQALLLEYKRKQLEEQRQAERLQRQLKQERDYLVSLQHQRQEQRPVEKKPLYHYKEGMSPSEK PAWAKEVEERSRLNRQSSPAMPHKVANRISDPNLPPRSESFSISGVQPARTPPMLRPVDPQIPHLVAVKSQGPALTASQSVHEQPTKGLS GFQEALNVTSHRVEMPRQNSDPTSENPPLPTRIEKFDRSSWLRQEEDIPPKVPQRTTSISPALARKNSPGNGSALGPRLGSQPIRASNPD LRRTEPILESPLQRTSSGSSSSSSTPSSQPSSQGGSQPGSQAGSSERTRVRANSKSEGSPVLPHEPAKVKPEESRDITRPSRPASYKKAI | 813_TNIK_DPPA2 |
Top |
Comparison of Fusion Protein Isoforms |
Superimpose the 3D Structures Among All Fusion Protein Isoforms * Download the pdb file and open it from the molstar online viewer. |
Comparison of the Secondary Structures of Fusion Protein Isoforms |
Top |
Comparison of Fusion Protein Sequences/Structures with Known Sequences/Structures from PDB |
Top |
pLDDT score distribution |
pLDDT score distribution of the predicted fusion protein structures from AlphaFold2 * AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. * The blue color at the bottom marks the best active site residues. |
282_TNIK_DPPA2.png |
282_TNIK_DPPA2.png |
Top |
Potential Active Site Information |
The potential binding sites of these fusion proteins were identified using SiteMap, a module of the Schrodinger suite. |
Kinase Fusion AA seq ID in KinaseFusionDB | Site score | Size | Dscore | Volume | Exposure | Enclosure | Contact | Phobic | Philic | Balance | Don/Acc | Residues |
Top |
Ramachandran Plot of Kinase Fusion Protein Structure |
Ramachandran plot of the torsional angles - phi (φ)and psi (ψ) - of the residues (amino acids) contained in this fusion protein peptide. |
282_TNIK_DPPA2_ramachandran.png |
Top |
Virtual Screening Results |
Distribution of the average docking score across all approved kinase inhibitors. Distribution of the number of occurrence across all approved kinase inhibitors. |
5'-kinase fusion protein case |
3'-kinase fusion protein case |
Top |
Drug information from DrugBank of the top 20 interacting small molecules. * The detailed information of individual kinase inhibitors are available in the download page. |
Fusion gene name info | Drug | Docking score | Glide g score | Glide energy |
282_TNIK_DPPA2-DOCK_HTVS_1-001 | Lenvatinib | -8.04532 | -8.04532 | -47.9191 |
282_TNIK_DPPA2-DOCK_HTVS_1-001 | Pexidartinib | -7.8495800000000004 | -8.06638 | -40.6205 |
282_TNIK_DPPA2-DOCK_HTVS_1-001 | Pexidartinib | -7.8495800000000004 | -8.06638 | -40.6205 |
282_TNIK_DPPA2-DOCK_HTVS_1-001 | Pralsetinib | -7.05342 | -7.14492 | -56.9759 |
282_TNIK_DPPA2-DOCK_HTVS_1-001 | Crizotinib | -7.0529399999999995 | -7.548839999999999 | -51.1512 |
282_TNIK_DPPA2-DOCK_HTVS_1-001 | Crizotinib | -7.0529399999999995 | -7.548839999999999 | -51.1512 |
282_TNIK_DPPA2-DOCK_HTVS_1-001 | Crizotinib | -7.03959 | -7.375789999999999 | -51.5185 |
282_TNIK_DPPA2-DOCK_HTVS_1-001 | Crizotinib | -7.03959 | -7.375789999999999 | -51.5185 |
282_TNIK_DPPA2-DOCK_HTVS_1-001 | Selpercatinib | -6.997310000000001 | -7.027810000000001 | -43.6444 |
282_TNIK_DPPA2-DOCK_HTVS_1-001 | Midostaurin | -6.890460000000001 | -6.890460000000001 | -46.7156 |
282_TNIK_DPPA2-DOCK_HTVS_1-001 | Baricitinib | -6.73287 | -6.73287 | -42.2933 |
282_TNIK_DPPA2-DOCK_HTVS_1-001 | Pralsetinib | -6.6414100000000005 | -6.73291 | -59.1231 |
282_TNIK_DPPA2-DOCK_HTVS_1-001 | Netarsudil | -6.54399 | -6.55509 | -50.1484 |
282_TNIK_DPPA2-DOCK_HTVS_1-001 | Netarsudil | -6.54399 | -6.55509 | -50.1484 |
282_TNIK_DPPA2-DOCK_HTVS_1-001 | Tivozanib | -6.51706 | -6.51706 | -38.0875 |
282_TNIK_DPPA2-DOCK_HTVS_1-001 | Midostaurin | -6.32158 | -6.32158 | -55.5195 |
282_TNIK_DPPA2-DOCK_HTVS_1-001 | Sunitinib | -6.27144 | -6.27564 | -48.9264 |
282_TNIK_DPPA2-DOCK_HTVS_1-001 | Palbociclib | -6.2554099999999995 | -6.662310000000001 | -49.8088 |
282_TNIK_DPPA2-DOCK_HTVS_1-001 | Palbociclib | -6.2554099999999995 | -6.662310000000001 | -49.8088 |
282_TNIK_DPPA2-DOCK_HTVS_1-001 | Palbociclib | -6.245430000000001 | -6.65233 | -49.5019 |
Top |
Kinase-Substrate Information of TNIK_DPPA2 |
Phosphorylation target of the kinase (phosphosite, 03-17-2024) |
Kinase | Kinase UniProt Acc | Kinase species | Substrate | Substrate UniProt Acc | Substrate phosphorylated residues | Substrate phosphorylated sites (+/-7AA) | Domain |
TNIK | Q9UKE5 | human | SMAD1 | Q15797 | T322 | sNVNRNStIENTRRH | MH2 |
TNIK | Q9UKE5 | human | TCF7L2 | Q9NQB0 | S177 | QALkDARsPsPAHIV | CTNNB1_binding |
TNIK | Q9UKE5 | human | HTT | P42858 | S13 | kLMkAFEsLksFQQQ | |
TNIK | Q9UKE5 | human | HTT | P42858 | T3 | _____MAtLEkLMkA |
Biological Network Integration of This Kinase and Substrates (GeneMANIA website) |
Enriched GO biological processes of the phosphorylation target genes of the kinase |
Kinase | GOID | GO term | P.adjust |
TNIK | ID | Description | 0.00e+00 |
TNIK | GO:2001237 | negative regulation of extrinsic apoptotic signaling pathway | 2.23e-02 |
TNIK | GO:2001236 | regulation of extrinsic apoptotic signaling pathway | 2.78e-02 |
TNIK | GO:0097191 | extrinsic apoptotic signaling pathway | 2.78e-02 |
TNIK | GO:2001234 | negative regulation of apoptotic signaling pathway | 2.78e-02 |
TNIK | GO:0033002 | muscle cell proliferation | 2.78e-02 |
TNIK | GO:0045165 | cell fate commitment | 3.10e-02 |
TNIK | GO:2001233 | regulation of apoptotic signaling pathway | 4.35e-02 |
TNIK | GO:0097050 | type B pancreatic cell apoptotic process | 4.35e-02 |
TNIK | GO:0098598 | learned vocalization behavior or vocal learning | 4.35e-02 |
TNIK | GO:0099004 | calmodulin dependent kinase signaling pathway | 4.35e-02 |
TNIK | GO:0031223 | auditory behavior | 4.35e-02 |
TNIK | GO:0007638 | mechanosensory behavior | 4.35e-02 |
TNIK | GO:0042762 | regulation of sulfur metabolic process | 4.35e-02 |
TNIK | GO:1903599 | positive regulation of autophagy of mitochondrion | 4.35e-02 |
TNIK | GO:2000479 | regulation of cAMP-dependent protein kinase activity | 4.35e-02 |
TNIK | GO:0001710 | mesodermal cell fate commitment | 4.35e-02 |
TNIK | GO:1901522 | positive regulation of transcription from RNA polymerase II promoter involved in cellular response to chemical stimulus | 4.35e-02 |
TNIK | GO:0045721 | negative regulation of gluconeogenesis | 4.38e-02 |
TNIK | GO:0031053 | primary miRNA processing | 4.38e-02 |
TNIK | GO:0010560 | positive regulation of glycoprotein biosynthetic process | 4.38e-02 |
TNIK | GO:1903020 | positive regulation of glycoprotein metabolic process | 4.38e-02 |
TNIK | GO:0045724 | positive regulation of cilium assembly | 4.38e-02 |
TNIK | GO:1903672 | positive regulation of sprouting angiogenesis | 4.38e-02 |
TNIK | GO:1901021 | positive regulation of calcium ion transmembrane transporter activity | 4.38e-02 |
TNIK | GO:0010996 | response to auditory stimulus | 4.38e-02 |
TNIK | GO:0060795 | cell fate commitment involved in formation of primary germ layer | 4.38e-02 |
TNIK | GO:0061036 | positive regulation of cartilage development | 4.38e-02 |
TNIK | GO:0015012 | heparan sulfate proteoglycan biosynthetic process | 4.38e-02 |
TNIK | GO:0048333 | mesodermal cell differentiation | 4.38e-02 |
TNIK | GO:0000132 | establishment of mitotic spindle orientation | 4.38e-02 |
TNIK | GO:0003161 | cardiac conduction system development | 4.38e-02 |
TNIK | GO:0032350 | regulation of hormone metabolic process | 4.38e-02 |
TNIK | GO:0040001 | establishment of mitotic spindle localization | 4.38e-02 |
TNIK | GO:1903146 | regulation of autophagy of mitochondrion | 4.38e-02 |
TNIK | GO:0051281 | positive regulation of release of sequestered calcium ion into cytosol | 4.38e-02 |
TNIK | GO:0051294 | establishment of spindle orientation | 4.38e-02 |
TNIK | GO:0047496 | vesicle transport along microtubule | 4.38e-02 |
TNIK | GO:0035196 | miRNA processing | 4.38e-02 |
TNIK | GO:0043666 | regulation of phosphoprotein phosphatase activity | 4.38e-02 |
TNIK | GO:0031648 | protein destabilization | 4.38e-02 |
TNIK | GO:2001259 | positive regulation of cation channel activity | 4.38e-02 |
TNIK | GO:0006890 | retrograde vesicle-mediated transpor | 8.24e-03 |
TNIK | GO:0006111 | regulation of gluconeogenesis | 4.38e-02 |
TNIK | GO:0010559 | regulation of glycoprotein biosynthetic process | 4.38e-02 |
TNIK | GO:0045912 | negative regulation of carbohydrate metabolic process | 4.38e-02 |
TNIK | GO:0051293 | establishment of spindle localization | 4.38e-02 |
TNIK | GO:0010718 | positive regulation of epithelial to mesenchymal transition | 4.38e-02 |
TNIK | GO:0060038 | cardiac muscle cell proliferation | 4.38e-02 |
TNIK | GO:0010921 | regulation of phosphatase activity | 4.38e-02 |
Top |
Related Drugs to TNIK_DPPA2 |
Drugs used for this fusion-positive patient. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Drug | Source | PMID |
Distribution of the number of studies mentioning TNIK-DPPA2 and kinase inhibitors the PubMed Abstract (04-01-2024) |
Fusion gene - drug pair 1 | Fusion gene - drug pair 2 | PMID | Publication date | DOI | Study title |
Top |
Related Diseases to TNIK_DPPA2 |
Diseases that have this fusion gene. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Disease | Source | PMID |
Related diseases from the literature mentioned this fusion gene and drug. (PubMed, 04-01-2024) |
MeSH ID | MeSH term |
Diseases associated with fusion partners. (DisGeNet 4.0) |
Partner | Gene | Disease ID | Disease name | # pubmeds | Source |
Top |
Clinical Trials of the Found Drugs/Small Molecules |
Statistics of the Clinical Trials of the Found Kinase Inibitors from clinicaltrials.gov (06-17-2024) |
Clinical Trials from clinicaltrials.gov (06-17-2024) |
Fusion Gene | Kinase Inhibitor | NCT ID | Study Status | Phases | Disease | # Enrolment | Date |