UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
|
Kinase Fusion Gene:TUFT1_PRKCA |
Kinase Fusion Protein Summary |
Kinase Fusion gene summary |
Kinase Fusion partner gene information | Kinase Fusion gene name: TUFT1_PRKCA | KinaseFusionDB ID: KFG6919 | FusionGDB2.0 ID: KFG6919 | Hgene | Tgene | Gene symbol | TUFT1 | PRKCA | Gene ID | 7286 | 5578 | |
Gene name | tuftelin 1 | protein kinase C alpha | ||||||||||
Synonyms | WHSF | AAG6|PKC-alpha|PKCA|PKCI+/-|PKCalpha|PRKACA | ||||||||||
Cytomap | 1q21.3 | 17q24.2 | ||||||||||
Type of gene | protein-coding | protein-coding | ||||||||||
Description | tuftelin | protein kinase C alpha typePKC-Aaging-associated gene 6 | ||||||||||
Modification date | 20240407 | 20240403 | ||||||||||
UniProtAcc | Q9NNX1 | P17252 | ||||||||||
Ensembl transtripts involved in fusion gene | ENST ids | ENST00000353024, ENST00000368848, ENST00000368849, ENST00000392712, ENST00000538902, | ENST00000583361, ENST00000413366, | |||||||||
Context (manual curation of fusion genes in KinaseFusionDB) | PubMed: TUFT1 [Title/Abstract] AND PRKCA [Title/Abstract] AND fusion [Title/Abstract] | |||||||||||
Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) | TUFT1(151512902)-PRKCA(64782985), # samples:2 |
Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
Partner | Gene | GO ID | GO term | PubMed ID |
Tgene | PRKCA | GO:0006468 | protein phosphorylation | 10770950 |
Tgene | PRKCA | GO:0043536 | positive regulation of blood vessel endothelial cell migration | 20011604 |
Tgene | PRKCA | GO:0043687 | post-translational protein modification | 20228790 |
Tgene | PRKCA | GO:0090330 | regulation of platelet aggregation | 12724315 |
Tgene | PRKCA | GO:0110063 | positive regulation of angiotensin-activated signaling pathway | 25313067 |
Kinase Fusion gene breakpoints across TUFT1 (5'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Kinase Fusion gene breakpoints across PRKCA (3'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Top |
Kinase Fusion Gene Sample Information |
Kinase Fusion gene information. |
Kinase Fusion gene information from four resources (ChiTars 5.0, ChimerDB 4.0, COSMIC, and CCLE) * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
Source | Sample | Hgene | Hchr | Hbp | Tgene | Tchr | Tbp |
ChimerDB4 | TCGA-A2-A1FW-01A | TUFT1 | chr1 | 151512901 | PRKCA | chr17 | 64782984 |
ChimerDB4 | TCGA-A2-A1FW-01A | TUFT1 | chr1 | 151512902 | PRKCA | chr17 | 64782985 |
ChimerDB4 | TCGA-A2-A1FW | TUFT1 | chr1 | 151512902 | PRKCA | chr17 | 64782984 |
ChimerDB4 | TCGA-A2-A1FW | TUFT1 | chr1 | 151512902 | PRKCA | chr17 | 64784956 |
Top |
Kinase Fusion ORF Analysis |
Kinase Fusion information from ORFfinder translation from full-length transcript sequence from KinaseFusionDB. |
Henst | Tenst | Hgene | Hchr | Hbp | Tgene | Tchr | Tbp | Seq length (transcript) | Seq length (amino acids) |
ENST00000353024 | ENST00000413366 | TUFT1 | chr1 | 151512902 | PRKCA | chr17 | 64782985 | 7242 | 187 |
ENST00000353024 | ENST00000413366 | TUFT1 | chr1 | 151512902 | PRKCA | chr17 | 64782984 | 7242 | 187 |
ENST00000353024 | ENST00000413366 | TUFT1 | chr1 | 151512902 | PRKCA | chr17 | 64784956 | 7134 | 187 |
ENST00000353024 | ENST00000413366 | TUFT1 | chr1 | 151512901 | PRKCA | chr17 | 64782984 | 7242 | 187 |
Top |
Kinase Fusion Amino Acid Sequences |
For individual full-length fusion transcript sequence from KinaseFusionDB, we ran ORFfinder and chose the longest ORF among the all predicted ones. |
>Henst_Tenst_Hgene_Hchr_Hbp_Tgene_Tchr_Tbp_length(fusion AA)_AAseq >ENST00000353024_ENST00000413366_TUFT1_chr1_151512902_PRKCA_chr17_64782985_length(amino acids)=187 MPSFMHHRHRDSRGSWLPCPCSPAGQCMIWVRVLTRCSSFDPRGKGLVYRKSLGDKRASPPAQNGAAAGQTPTRPPREEEDPTEEHMRLG TLVQHPKQPACLKQAAGLGLPCNPNTHKFVSLGNTFTVSAGCYSLRPYGKVFQENAPTGVPSTLPEGQQTSEQTPREKQSKSGPGAVLSC -------------------------------------------------------------- >ENST00000353024_ENST00000413366_TUFT1_chr1_151512902_PRKCA_chr17_64782984_length(amino acids)=187 MPSFMHHRHRDSRGSWLPCPCSPAGQCMIWVRVLTRCSSFDPRGKGLVYRKSLGDKRASPPAQNGAAAGQTPTRPPREEEDPTEEHMRLG TLVQHPKQPACLKQAAGLGLPCNPNTHKFVSLGNTFTVSAGCYSLRPYGKVFQENAPTGVPSTLPEGQQTSEQTPREKQSKSGPGAVLSC -------------------------------------------------------------- >ENST00000353024_ENST00000413366_TUFT1_chr1_151512902_PRKCA_chr17_64784956_length(amino acids)=187 MPSFMHHRHRDSRGSWLPCPCSPAGQCMIWVRVLTRCSSFDPRGKGLVYRKSLGDKRASPPAQNGAAAGQTPTRPPREEEDPTEEHMRLG TLVQHPKQPACLKQAAGLGLPCNPNTHKFVSLGNTFTVSAGCYSLRPYGKVFQENAPTGVPSTLPEGQQTSEQTPREKQSKSGPGAVLSC -------------------------------------------------------------- >ENST00000353024_ENST00000413366_TUFT1_chr1_151512901_PRKCA_chr17_64782984_length(amino acids)=187 MPSFMHHRHRDSRGSWLPCPCSPAGQCMIWVRVLTRCSSFDPRGKGLVYRKSLGDKRASPPAQNGAAAGQTPTRPPREEEDPTEEHMRLG TLVQHPKQPACLKQAAGLGLPCNPNTHKFVSLGNTFTVSAGCYSLRPYGKVFQENAPTGVPSTLPEGQQTSEQTPREKQSKSGPGAVLSC -------------------------------------------------------------- |
Multiple Sequence Alignment of All Fusion Protein Isoforms |
Top |
Kinase Fusion Protein Functional Features |
Four levels of functional features of fusion genes Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr1:151512902/chr17:64782985) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
Main function of each fusion partner protein. (from UniProt) |
Hgene | Tgene |
TUFT1 | PRKCA |
FUNCTION: Involved in the mineralization and structural organization of enamel. {ECO:0000250|UniProtKB:P27628}. | FUNCTION: Calcium-activated, phospholipid- and diacylglycerol (DAG)-dependent serine/threonine-protein kinase that is involved in positive and negative regulation of cell proliferation, apoptosis, differentiation, migration and adhesion, tumorigenesis, cardiac hypertrophy, angiogenesis, platelet function and inflammation, by directly phosphorylating targets such as RAF1, BCL2, CSPG4, TNNT2/CTNT, or activating signaling cascade involving MAPK1/3 (ERK1/2) and RAP1GAP. Involved in cell proliferation and cell growth arrest by positive and negative regulation of the cell cycle. Can promote cell growth by phosphorylating and activating RAF1, which mediates the activation of the MAPK/ERK signaling cascade, and/or by up-regulating CDKN1A, which facilitates active cyclin-dependent kinase (CDK) complex formation in glioma cells. In intestinal cells stimulated by the phorbol ester PMA, can trigger a cell cycle arrest program which is associated with the accumulation of the hyper-phosphorylated growth-suppressive form of RB1 and induction of the CDK inhibitors CDKN1A and CDKN1B. Exhibits anti-apoptotic function in glioma cells and protects them from apoptosis by suppressing the p53/TP53-mediated activation of IGFBP3, and in leukemia cells mediates anti-apoptotic action by phosphorylating BCL2. During macrophage differentiation induced by macrophage colony-stimulating factor (CSF1), is translocated to the nucleus and is associated with macrophage development. After wounding, translocates from focal contacts to lamellipodia and participates in the modulation of desmosomal adhesion. Plays a role in cell motility by phosphorylating CSPG4, which induces association of CSPG4 with extensive lamellipodia at the cell periphery and polarization of the cell accompanied by increases in cell motility. During chemokine-induced CD4(+) T cell migration, phosphorylates CDC42-guanine exchange factor DOCK8 resulting in its dissociation from LRCH1 and the activation of GTPase CDC42 (PubMed:28028151). Is highly expressed in a number of cancer cells where it can act as a tumor promoter and is implicated in malignant phenotypes of several tumors such as gliomas and breast cancers. Negatively regulates myocardial contractility and positively regulates angiogenesis, platelet aggregation and thrombus formation in arteries. Mediates hypertrophic growth of neonatal cardiomyocytes, in part through a MAPK1/3 (ERK1/2)-dependent signaling pathway, and upon PMA treatment, is required to induce cardiomyocyte hypertrophy up to heart failure and death, by increasing protein synthesis, protein-DNA ratio and cell surface area. Regulates cardiomyocyte function by phosphorylating cardiac troponin T (TNNT2/CTNT), which induces significant reduction in actomyosin ATPase activity, myofilament calcium sensitivity and myocardial contractility. In angiogenesis, is required for full endothelial cell migration, adhesion to vitronectin (VTN), and vascular endothelial growth factor A (VEGFA)-dependent regulation of kinase activation and vascular tube formation. Involved in the stabilization of VEGFA mRNA at post-transcriptional level and mediates VEGFA-induced cell proliferation. In the regulation of calcium-induced platelet aggregation, mediates signals from the CD36/GP4 receptor for granule release, and activates the integrin heterodimer ITGA2B-ITGB3 through the RAP1GAP pathway for adhesion. During response to lipopolysaccharides (LPS), may regulate selective LPS-induced macrophage functions involved in host defense and inflammation. But in some inflammatory responses, may negatively regulate NF-kappa-B-induced genes, through IL1A-dependent induction of NF-kappa-B inhibitor alpha (NFKBIA/IKBA). Upon stimulation with 12-O-tetradecanoylphorbol-13-acetate (TPA), phosphorylates EIF4G1, which modulates EIF4G1 binding to MKNK1 and may be involved in the regulation of EIF4E phosphorylation. Phosphorylates KIT, leading to inhibition of KIT activity. Phosphorylates ATF2 which promotes cooperation between ATF2 and JUN, activating transcription. Phosphorylates SOCS2 at 'Ser-52' facilitating its ubiquitination and proteasomal degradation (By similarity). Phosphorylates KLHL3 in response to angiotensin II signaling, decreasing the interaction between KLHL3 and WNK4 (PubMed:25313067). {ECO:0000250|UniProtKB:P20444, ECO:0000269|PubMed:10848585, ECO:0000269|PubMed:11909826, ECO:0000269|PubMed:12724315, ECO:0000269|PubMed:12832403, ECO:0000269|PubMed:15016832, ECO:0000269|PubMed:15504744, ECO:0000269|PubMed:15526160, ECO:0000269|PubMed:18056764, ECO:0000269|PubMed:19176525, ECO:0000269|PubMed:21576361, ECO:0000269|PubMed:23990668, ECO:0000269|PubMed:25313067, ECO:0000269|PubMed:28028151, ECO:0000269|PubMed:9738012, ECO:0000269|PubMed:9830023, ECO:0000269|PubMed:9873035, ECO:0000269|PubMed:9927633}. |
Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
- Retained domain in the 5'-partner of fusion protein (protein functional feature from UniProt). |
Partner | Hgeneene | Hbp | Tgeneene | Tbp | ENST | BPexon | TotalExon | Protein feature loci | BPloci | TotalLen | Feature | Note |
- Retained domain in the 3'-partner of fusion protein (protein functional feature from UniProt). |
Partner | Hgeneene | Hbp | Tgeneene | Tbp | ENST | BPexon | TotalExon | Protein feature loci | BPloci | TotalLen | Feature | Note |
Tgene | TUFT1 | 151512901 | PRKCA | 64782984 | ENST00000353024 | 13 | 17 | 598_668 | 535 | 673 | Domain | Note=AGC-kinase C-terminal;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00618 |
Tgene | TUFT1 | 151512902 | PRKCA | 64782984 | ENST00000353024 | 13 | 17 | 598_668 | 535 | 673 | Domain | Note=AGC-kinase C-terminal;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00618 |
Tgene | TUFT1 | 151512902 | PRKCA | 64782985 | ENST00000353024 | 13 | 17 | 598_668 | 535 | 673 | Domain | Note=AGC-kinase C-terminal;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00618 |
Tgene | TUFT1 | 151512902 | PRKCA | 64784956 | ENST00000353024 | 14 | 17 | 598_668 | 571 | 673 | Domain | Note=AGC-kinase C-terminal;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00618 |
Top |
Kinase Fusion Protein Structures |
CIF files of the predicted kinase fusion proteins * Here we show the 3D structure of the fusion proteins using Mol*. AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Model confidence is shown from the pLDDT values per residue. pLDDT corresponds to the model’s prediction of its score on the local Distance Difference Test. It is a measure of local accuracy (from AlphfaFold website). To color code individual residues, we transformed individual PDB files into CIF format. |
Kinase Fusion protein CIF link (fusion AA seq ID in KinaseFusionDB) | Henst | Tenst | Hgene | Hchr | Hbp | Tgene | Tchr | Tbp | AA seq | Len(AA seq) |
PDB file >>>539_TUFT1_PRKCA | ENST00000353024 | ENST00000413366 | TUFT1 | chr1 | 151512901 | PRKCA | chr17 | 64782984 | MPSFMHHRHRDSRGSWLPCPCSPAGQCMIWVRVLTRCSSFDPRGKGLVYRKSLGDKRASPPAQNGAAAGQTPTRPPREEEDPTEEHMRLG TLVQHPKQPACLKQAAGLGLPCNPNTHKFVSLGNTFTVSAGCYSLRPYGKVFQENAPTGVPSTLPEGQQTSEQTPREKQSKSGPGAVLSC | 187 |
3D view using mol* of 539_TUFT1_PRKCA | ||||||||||
PDB file >>>TKFP_925_TUFT1_PRKCA | ENST00000353024 | ENST00000413366 | TUFT1 | chr1 | 151512902 | PRKCA | chr17 | 64782985 | MPSFMHHRHRDSRGSWLPCPCSPAGQCMIWVRVLTRCSSFDPRGKGLVYRKSLGDKRASPPAQNGAAAGQTPTRPPREEEDPTEEHMRLG TLVQHPKQPACLKQAAGLGLPCNPNTHKFVSLGNTFTVSAGCYSLRPYGKVFQENAPTGVPSTLPEGQQTSEQTPREKQSKSGPGAVLSC | 187_TUFT1_PRKCA |
PDB file >>>TKFP_926_TUFT1_PRKCA | ENST00000353024 | ENST00000413366 | TUFT1 | chr1 | 151512902 | PRKCA | chr17 | 64782984 | MPSFMHHRHRDSRGSWLPCPCSPAGQCMIWVRVLTRCSSFDPRGKGLVYRKSLGDKRASPPAQNGAAAGQTPTRPPREEEDPTEEHMRLG TLVQHPKQPACLKQAAGLGLPCNPNTHKFVSLGNTFTVSAGCYSLRPYGKVFQENAPTGVPSTLPEGQQTSEQTPREKQSKSGPGAVLSC | 187_TUFT1_PRKCA |
PDB file >>>TKFP_927_TUFT1_PRKCA | ENST00000353024 | ENST00000413366 | TUFT1 | chr1 | 151512902 | PRKCA | chr17 | 64784956 | MPSFMHHRHRDSRGSWLPCPCSPAGQCMIWVRVLTRCSSFDPRGKGLVYRKSLGDKRASPPAQNGAAAGQTPTRPPREEEDPTEEHMRLG TLVQHPKQPACLKQAAGLGLPCNPNTHKFVSLGNTFTVSAGCYSLRPYGKVFQENAPTGVPSTLPEGQQTSEQTPREKQSKSGPGAVLSC | 187_TUFT1_PRKCA |
PDB file >>>TKFP_928_TUFT1_PRKCA | ENST00000353024 | ENST00000413366 | TUFT1 | chr1 | 151512901 | PRKCA | chr17 | 64782984 | MPSFMHHRHRDSRGSWLPCPCSPAGQCMIWVRVLTRCSSFDPRGKGLVYRKSLGDKRASPPAQNGAAAGQTPTRPPREEEDPTEEHMRLG TLVQHPKQPACLKQAAGLGLPCNPNTHKFVSLGNTFTVSAGCYSLRPYGKVFQENAPTGVPSTLPEGQQTSEQTPREKQSKSGPGAVLSC | 187_TUFT1_PRKCA |
Top |
Comparison of Fusion Protein Isoforms |
Superimpose the 3D Structures Among All Fusion Protein Isoforms * Download the pdb file and open it from the molstar online viewer. |
Comparison of the Secondary Structures of Fusion Protein Isoforms |
Top |
Comparison of Fusion Protein Sequences/Structures with Known Sequences/Structures from PDB |
Top |
pLDDT score distribution |
pLDDT score distribution of the predicted fusion protein structures from AlphaFold2 * AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. * The blue color at the bottom marks the best active site residues. |
539_TUFT1_PRKCA.png |
539_TUFT1_PRKCA.png |
Top |
Potential Active Site Information |
The potential binding sites of these fusion proteins were identified using SiteMap, a module of the Schrodinger suite. |
Kinase Fusion AA seq ID in KinaseFusionDB | Site score | Size | Dscore | Volume | Exposure | Enclosure | Contact | Phobic | Philic | Balance | Don/Acc | Residues |
Top |
Ramachandran Plot of Kinase Fusion Protein Structure |
Ramachandran plot of the torsional angles - phi (φ)and psi (ψ) - of the residues (amino acids) contained in this fusion protein peptide. |
539_TUFT1_PRKCA_ramachandran.png |
Top |
Virtual Screening Results |
Distribution of the average docking score across all approved kinase inhibitors. Distribution of the number of occurrence across all approved kinase inhibitors. |
5'-kinase fusion protein case |
3'-kinase fusion protein case |
Top |
Drug information from DrugBank of the top 20 interacting small molecules. * The detailed information of individual kinase inhibitors are available in the download page. |
Fusion gene name info | Drug | Docking score | Glide g score | Glide energy |
539_TUFT1_PRKCA-DOCK_HTVS_1-001 | Brigatinib | -7.6852800000000006 | -7.69878 | -51.6414 |
539_TUFT1_PRKCA-DOCK_HTVS_1-001 | Brigatinib | -7.6852800000000006 | -7.69878 | -51.6414 |
539_TUFT1_PRKCA-DOCK_HTVS_1-001 | Sunitinib | -7.56122 | -7.56542 | -43.8021 |
539_TUFT1_PRKCA-DOCK_HTVS_1-001 | Pexidartinib | -7.527589999999999 | -7.744389999999999 | -33.1232 |
539_TUFT1_PRKCA-DOCK_HTVS_1-001 | Pexidartinib | -7.527589999999999 | -7.744389999999999 | -33.1232 |
539_TUFT1_PRKCA-DOCK_HTVS_1-001 | Selpercatinib | -7.421360000000001 | -7.451860000000001 | -51.4893 |
539_TUFT1_PRKCA-DOCK_HTVS_1-001 | Selpercatinib | -7.421360000000001 | -7.451860000000001 | -51.4893 |
539_TUFT1_PRKCA-DOCK_HTVS_1-001 | Neratinib | -7.30616 | -8.20846 | -59.0848 |
539_TUFT1_PRKCA-DOCK_HTVS_1-001 | Neratinib | -7.30616 | -8.20846 | -59.0848 |
539_TUFT1_PRKCA-DOCK_HTVS_1-001 | Larotrectinib | -7.20126 | -7.20126 | -44.1846 |
539_TUFT1_PRKCA-DOCK_HTVS_1-001 | Selpercatinib | -7.11694 | -7.14744 | -48.2166 |
539_TUFT1_PRKCA-DOCK_HTVS_1-001 | Selpercatinib | -7.11694 | -7.14744 | -48.2166 |
539_TUFT1_PRKCA-DOCK_HTVS_1-001 | Neratinib | -6.96215 | -7.86805 | -52.7008 |
539_TUFT1_PRKCA-DOCK_HTVS_1-001 | Pralsetinib | -6.954860000000001 | -7.046360000000001 | -34.504 |
539_TUFT1_PRKCA-DOCK_HTVS_1-001 | Selpercatinib | -6.910819999999999 | -6.941319999999999 | -48.5684 |
539_TUFT1_PRKCA-DOCK_HTVS_1-001 | Cobimetinib | -6.77715 | -6.77995 | -46.3498 |
539_TUFT1_PRKCA-DOCK_HTVS_1-001 | Pralsetinib | -6.760039999999999 | -6.851539999999999 | -43.4569 |
539_TUFT1_PRKCA-DOCK_HTVS_1-001 | Nilotinib | -6.70828 | -6.84788 | -44.3249 |
539_TUFT1_PRKCA-DOCK_HTVS_1-001 | Nilotinib | -6.70828 | -6.84788 | -44.3249 |
539_TUFT1_PRKCA-DOCK_HTVS_1-001 | Ibrutinib | -6.70144 | -6.70144 | -36.9096 |
Top |
Kinase-Substrate Information of TUFT1_PRKCA |
Phosphorylation target of the kinase (phosphosite, 03-17-2024) |
Kinase | Kinase UniProt Acc | Kinase species | Substrate | Substrate UniProt Acc | Substrate phosphorylated residues | Substrate phosphorylated sites (+/-7AA) | Domain |
PRKCA | P17252 | human | NOS3 | P29474 | T495 | TGITRKKtFKEVANA | |
PRKCA | P17252 | human | TACSTD2 | P09758 | S303 | VITNRRKsGKYKKVE | |
PRKCA | P17252 | human | JPH2 | Q9BR39 | S165 | PLRTsLssLRsEHsN | |
PRKCA | P17252 | human | TOP1 | P11387 | S21 | ADFRLNDsHKHKDKH | |
PRKCA | P17252 | human | CYP2E1 | P05181 | S247 | AEVKEyVsERVkEHH | p450 |
PRKCA | P17252 | human | NCF4 | Q15080 | S315 | RQARGLPsQKRLFPW | PB1 |
PRKCA | P17252 | human | ANXA1 | P04083 | S28 | yVQtVksskGGPGsA | |
PRKCA | P17252 | human | PTPN1 | P18031 | S378 | RSRVVGGsLrGAQAA | |
PRKCA | P17252 | human | PLCG1 | P19174 | S1248 | HGrAREGsFEsRyQQ | |
PRKCA | P17252 | human | MAPT | P10636-8 | S352 | DFKDrVQskIGsLDN | Tubulin-binding |
PRKCA | P17252 | human | ADAP1 | O75689 | T276 | GFRkRWFtMDDRRLM | PH |
PRKCA | P17252 | human | SLC6A4 | P31645 | T603 | RLIITPGtFKERIIK | |
PRKCA | P17252 | human | ITGB2 | P05107 | S745 | FEkEKLksQWNNDNP | Integrin_b_cyt |
PRKCA | P17252 | human | GNAZ | P19086 | S16 | EKEAARRsRRIDRHL | G-alpha |
PRKCA | P17252 | human | C5AR1 | P21730 | S314 | FQGRLRKsLPsLLRN | |
PRKCA | P17252 | human | CDC42EP4 | Q9H3Q1 | S18 | sVHskRRsRADLtAE | |
PRKCA | P17252 | human | ARHGDIA | P52565 | S34 | ykPPAQKsIQEIQEL | Rho_GDI |
PRKCA | P17252 | human | CSNK1D | P48730 | T174 | YRENkNLtGtARYAs | Pkinase |
PRKCA | P17252 | human | XRCC6 | P12956 | S77 | VYISKIIssDRDLLA | Ku_N |
PRKCA | P17252 | human | CSNK1D | P48730 | S181 | tGtARYAsINTHLGI | Pkinase |
PRKCA | P17252 | human | NHERF1 | O14745 | S340 | RAHQKRssKRAPQMD | EBP50_C |
PRKCA | P17252 | human | ADAM17 | P78536 | T735 | kPFPAPQtPGRLQPA | |
PRKCA | P17252 | human | RRAD | P55042 | S257 | QIRLRRDsKEANARR | |
PRKCA | P17252 | human | SRF | P11831 | S162 | LRRYtTFsKRkTGIM | SRF-TF |
PRKCA | P17252 | human | VTN | P04004 | S393 | sRGRNQNsRRPsRAT | |
PRKCA | P17252 | human | ATP5F1C | P36542 | S146 | GILYRtHsDQFLVAF | ATP-synt |
PRKCA | P17252 | human | EGLN2 | Q96KS0 | S226 | LRDGQLVsQRAIPPR | |
PRKCA | P17252 | human | PPARA | Q07869 | S230 | VKARVILsGKASNNP | |
PRKCA | P17252 | human | EZR | P15311 | T567 | QGRDkyKtLRQIRQG | ERM_C |
PRKCA | P17252 | human | CDKN1A | P38936 | S146 | GRkRRQtsMTDFyHs | |
PRKCA | P17252 | human | SRF | P11831 | T159 | DNkLRRYtTFsKRkT | SRF-TF |
PRKCA | P17252 | human | CDC42EP4 | Q9H3Q1 | S80 | SskRsLLsRKFRGSK | PBD |
PRKCA | P17252 | human | GMFB | P60983 | S72 | QPRFIVYsYkYQHDD | Cofilin_ADF |
PRKCA | P17252 | human | CELF1 | Q92879 | S179 | QtMEGCssPMVVkFA | |
PRKCA | P17252 | human | KCNH2 | Q12809 | S890 | RQRKRKLsFRRRtDK | |
PRKCA | P17252 | human | ARHGAP35 | Q9NRY4 | S1236 | PKPKPRPsITKATWE | RhoGAP_pG1_pG2 |
PRKCA | P17252 | human | SPN | P16150 | S351 | tFFGRRKsRQGsLAM | |
PRKCA | P17252 | human | TRPV5 | Q9NQA5 | S299 | FLELVVSsDKREARQ | |
PRKCA | P17252 | human | FLOT1 | O75955 | S315 | QAEAEAAsVRMRGEA | |
PRKCA | P17252 | human | IGFBP1 | P08833 | S144 | NFHLMAPsEEDHSIL | |
PRKCA | P17252 | human | FLNC | Q14315 | S2624 | sSssRGssyssIPkF | |
PRKCA | P17252 | human | EIF6 | P56537 | S235 | QPstIAtsMRDsLID | |
PRKCA | P17252 | human | PTPN11 | Q06124 | S591 | GLMQQQksFR_____ | |
PRKCA | P17252 | human | CELF1 | Q92879 | S28 | GQVPrtWsEkDLREL | RRM_1 |
PRKCA | P17252 | human | MYH9 | P35579 | S1916 | AMNREVssLkNkLRr | Myosin_tail_1 |
PRKCA | P17252 | human | KCNE3 | Q9Y6H6 | S82 | LILGYTRsRKVDKRS | ISK_Channel |
PRKCA | P17252 | human | CTPS1 | P17812 | T455 | MRLGKRRtLFQTkNs | GATase |
PRKCA | P17252 | human | HRH1 | P35367 | S398 | WKRLRsHsRQyVSGL | 7tm_1 |
PRKCA | P17252 | human | CYP2E1 | P05181 | T69 | QRFGPVFtLYVGsQR | p450 |
PRKCA | P17252 | human | ANXA2 | P07355 | S26 | tPPsAyGsVkAytNF | |
PRKCA | P17252 | human | CYP3A4 | P08684 | T264 | KEsRLEDtQKHRVDF | p450 |
PRKCA | P17252 | human | NR1I2 | O75469 | T408 | RSINAQHtQRLLRIQ | Hormone_recep |
PRKCA | P17252 | human | SLC6A2 | P23975 | T258 | SLWKGVKtsGKVVWI | SNF |
PRKCA | P17252 | human | CSNK1D | P48730 | S53 | HPQLHIEskIYkMMQ | Pkinase |
PRKCA | P17252 | human | PLAU | P00749 | S158 | CADGKKPsSPPEELK | |
PRKCA | P17252 | human | CDKN2A | Q8N726 | T8 | MVRRFLVtLRIRRAC | P19Arf_N |
PRKCA | P17252 | human | CYSLTR1 | Q9Y271 | S315 | tFRKHsLssVTYVPR | |
PRKCA | P17252 | human | HDAC4 | P56524 | S632 | RPLSRAQssPAsAtF | |
PRKCA | P17252 | human | IL2RA | P01589 | S268 | WQRRQRKsRRtI___ | |
PRKCA | P17252 | human | SLC6A4 | P31645 | S149 | yHRNGCIsIWRKICP | SNF |
PRKCA | P17252 | human | CFTR | P13569 | S737 | EPLERRLsLVPDSEQ | CFTR_R |
PRKCA | P17252 | human | PPP2R5A | Q15172 | S41 | RQKRsQGssQFRsQG | |
PRKCA | P17252 | human | CFTR | P13569 | T682 | APVSWTEtKKQsFKQ | CFTR_R |
PRKCA | P17252 | human | RRAD | P55042 | S273 | AGTRRREsLGKKAKR | |
PRKCA | P17252 | human | ITGB4 | P16144 | S1356 | ysDDVLRsPSGsQRP | |
PRKCA | P17252 | human | KCNAB2 | Q13303 | S266 | IPPYSRAsLkGYQWL | Aldo_ket_red |
PRKCA | P17252 | human | MMP2 | P08253 | T377 | DGKMWCAttANYDDD | Peptidase_M10; fn2 |
PRKCA | P17252 | human | GRIN2A | Q12879 | S929 | ADFIQRGsLIMDMVS | NMDAR2_C |
PRKCA | P17252 | human | AQP1 | P29972 | T157 | VLCVLATtDRRRRDL | MIP |
PRKCA | P17252 | human | ITGB2 | P05107 | T758 | NPLFksAtttVMNPk | Integrin_b_cyt |
PRKCA | P17252 | human | CYP2E1 | P05181 | S56 | ELKNIPKsFtRLAQR | p450 |
PRKCA | P17252 | human | FLNC | Q14315 | S2623 | KsSssRGssyssIPk | |
PRKCA | P17252 | human | PRKCE | Q02156 | S316 | tPDKITNsGQRRkKL | |
PRKCA | P17252 | human | PLAU | P00749 | S323 | TGFGKENsTDYLYPE | Trypsin |
PRKCA | P17252 | human | LRP1 | Q07954 | S4523 | GsRHsLAsTDEkREL | |
PRKCA | P17252 | human | PDE3A | Q14432 | S293 | FkRRRRsssVVsAEM | |
PRKCA | P17252 | human | ADD2 | P35612 | S726 | KKKEKVEs_______ | |
PRKCA | P17252 | human | ULK1 | O75385 | S423 | GRAGPFSsSRCGAsV | |
PRKCA | P17252 | human | RRAD | P55042 | S214 | LVRSREVsVDEGRAC | Ras |
PRKCA | P17252 | human | TRPV6 | Q9H1D0 | T742 | WERLRQGtLRRDLRG | |
PRKCA | P17252 | human | KCNJ1 | P48048 | T193 | KKRAKtItFSKNAVI | IRK_C |
PRKCA | P17252 | human | VTN | P04004 | S397 | NQNsRRPsRATWLSL | |
PRKCA | P17252 | human | ADRA1D | P25100 | S334 | HtFRssLsVRLLKFS | 7tm_1 |
PRKCA | P17252 | human | ITGB1 | P05556 | S785 | GENPIyksAVttVVN | Integrin_b_cyt |
PRKCA | P17252 | human | EGLN2 | Q96KS0 | S132 | GGDAPsPsKRPWARQ | |
PRKCA | P17252 | human | ITGB4 | P16144-2 | S1424 | tLTRDyNsLTRSEHS | |
PRKCA | P17252 | human | CYP3A4 | P08684 | S131 | EEWkRLRsLLsPtFT | p450 |
PRKCA | P17252 | human | MAPKAP1 | Q9BPZ7 | S128 | kSLFEKKsLKEKPPI | SIN1 |
PRKCA | P17252 | human | AKT1 | P31749 | S473 | RPHFPQFsysAsGtA | Pkinase_C |
PRKCA | P17252 | human | PPP1R14A | Q96A00 | T38 | QkRHARVtVkYDRRE | PP1_inhibitor |
PRKCA | P17252 | human | NCF1 | P14598 | S320 | QRsRKRLsQDAYRRN | NECFESHC |
PRKCA | P17252 | human | TP53 | P04637 | S376 | LkskkGQstsRHkkL | |
PRKCA | P17252 | human | NOXA1 | Q86UR1 | S172 | DQVQRRGsLPPRQVP | |
PRKCA | P17252 | human | CD4 | P01730 | S440 | sQIkRLLsEKKTCQC | Tcell_CD4_C |
PRKCA | P17252 | human | RALB | P11234 | S198 | KSSKNKKsFKERCCL | |
PRKCA | P17252 | human | RALBP1 | Q15311 | S118 | VFKKPsFsKKKEKDF | |
PRKCA | P17252 | human | TNNI3 | P19429 | S23 | PAPIRRRssNyRAyA | Troponin-I_N |
PRKCA | P17252 | human | TUBA1C | Q9BQE3 | S165 | sVDyGkkskLEFSIy | Tubulin |
PRKCA | P17252 | human | EPHA2 | P29317 | S892 | ADFDPRVsIRLPsts | |
PRKCA | P17252 | human | ARHGDIB | P52566 | S31 | ykPPPQksLkELQEM | Rho_GDI |
PRKCA | P17252 | human | SLC18A2 | Q05940 | S15 | LVRWLQEsRRsRKLI | |
PRKCA | P17252 | human | AQP4 | P55087 | S180 | TIFASCDsKRTDVTG | MIP |
PRKCA | P17252 | human | PTPN12 | Q05209 | S435 | KKLERNLsFEIKKVP | |
PRKCA | P17252 | human | CYP3A4 | P08684 | S100 | VLVKECYsVFtNRRP | p450 |
PRKCA | P17252 | human | EGFR | P00533 | T678 | RHIVRKRtLRRLLQE | |
PRKCA | P17252 | human | GRK7 | Q8WTQ7 | S36 | ELQRRRRsLALPGLQ | |
PRKCA | P17252 | human | TFRC | P02786 | S24 | PLsytRFsLARQVDG | |
PRKCA | P17252 | human | INSR | P06213 | S1062 | AVkTVNEsAsLRERI | PK_Tyr_Ser-Thr |
PRKCA | P17252 | human | KCNC4 | Q03721 | S21 | KsGNKPPsKTCLKEE | Potassium_chann |
PRKCA | P17252 | human | AQP2 | P41181 | S256 | REVRRRQsVELHsPQ | |
PRKCA | P17252 | human | PRKAA1 | Q13131 | S496 | AtPQRsGsVsNyRSC | AdenylateSensor |
PRKCA | P17252 | human | PTPN11 | Q06124 | S576 | CAEMREDsARVyENV | |
PRKCA | P17252 | human | PRKG1 | Q13976 | T59 | THIGPRTtRAQGIsA | |
PRKCA | P17252 | human | SLC6A2 | P23975 | S259 | LWKGVKtsGKVVWIT | SNF |
PRKCA | P17252 | human | NOX5 | Q96PH1-4 | T494 | KRLsRSVtMRKsQRS | FAD_binding_8 |
PRKCA | P17252 | human | CASR | P41180 | S875 | TIEEVRCsTAAHAFK | |
PRKCA | P17252 | human | NCOR1 | O75376 | S70 | QQLRRRPsLLsEFHP | |
PRKCA | P17252 | human | EPB41 | P11171-4 | S312 | QAQTRQAsALIDRPA | FA |
PRKCA | P17252 | human | ADRA1D | P25100 | S332 | KGHtFRssLsVRLLK | 7tm_1 |
PRKCA | P17252 | human | CDKN1A | P38936 | S153 | sMTDFyHskRrLIFS | |
PRKCA | P17252 | human | CYP2E1 | P05181 | S424 | ENGkFkYsDYFkPFs | p450 |
PRKCA | P17252 | human | GRIA1 | P42261 | S836 | cYKsRsEsKRMKGFC | |
PRKCA | P17252 | human | RIGI | O95786 | T170 | DkENWPktLkLALEk | CARD_2 |
PRKCA | P17252 | human | PPARA | Q07869 | S179 | RFGRMPRsEKAKLkA | |
PRKCA | P17252 | human | TNNI3 | P19429 | T143 | RGKFKRPtLRrVrIs | Troponin |
PRKCA | P17252 | human | RSC1A1 | Q92681 | S366 | LHELLVVsSkPASEN | |
PRKCA | P17252 | human | ADAP1 | O75689 | S87 | AARARFEsKVPSFYY | ArfGap |
PRKCA | P17252 | human | NHERF1 | O14745 | S339 | ERAHQKRssKRAPQM | EBP50_C |
PRKCA | P17252 | human | LCP1 | P13796 | S5 | ___MARGsVsDEEMM | |
PRKCA | P17252 | human | ARHGEF1 | Q92888 | S240 | TkSGDKKsGRNFFRK | |
PRKCA | P17252 | human | NRGN | Q92686 | S36 | AAAKIQAsFrGHMAR | IQ |
PRKCA | P17252 | human | MAPT | P10636-8 | S324 | kVTskCGsLGNIHHk | Tubulin-binding |
PRKCA | P17252 | human | VIM | P08670 | S8 | MStrsVssssyrrMF | Filament_head |
PRKCA | P17252 | human | UGT1A3 | P35503 | S43 | IDGSHWLsMREVLRE | UDPGT |
PRKCA | P17252 | human | GRIN2B | Q13224 | S1323 | ALAPRSVsLKDKGRF | NMDAR2_C |
PRKCA | P17252 | human | LCK | P06239 | S42 | tLLIRNGsEVRDPLV | |
PRKCA | P17252 | human | VIM | P08670 | S9 | StrsVssssyrrMFG | Filament_head |
PRKCA | P17252 | human | L1CAM | P32004 | T1172 | ARPMkDEtFGEyRSL | Bravo_FIGEY |
PRKCA | P17252 | human | RRAD | P55042 | S290 | GRIVARNsRKMAFRA | |
PRKCA | P17252 | human | PITPNC1 | Q9UKF7 | S274 | SVRsAPSsAPstPLs | |
PRKCA | P17252 | human | PGR | P06401 | S400 | GAEAsARsPRSYLVA | Prog_receptor |
PRKCA | P17252 | human | CYP2E1 | P05181 | T387 | GYLIPKGtVVVPTLD | p450 |
PRKCA | P17252 | human | MARCKS | P29966 | S163 | KRFsFkKsFkLsGFs | MARCKS |
PRKCA | P17252 | human | TRPM4 | Q8TD43 | S1152 | sERLKRTsQKVDLAL | |
PRKCA | P17252 | human | CELF1 | Q92879 | T173 | kAMHQAQtMEGCssP | RRM_1 |
PRKCA | P17252 | human | FBXW7 | Q969H0 | S10 | QELLSVGsKRRRTGG | |
PRKCA | P17252 | human | JAK2 | O60674 | S518 | VFRTNGVsDVPtsPT | |
PRKCA | P17252 | human | CFL1 | P23528 | S23 | NDMkVRksstPEEVk | Cofilin_ADF |
PRKCA | P17252 | human | PRKCE | Q02156 | S234 | EtPDQVGsQRFSVNM | |
PRKCA | P17252 | human | CYSLTR1 | Q9Y271 | S313 | LstFRKHsLssVTYV | |
PRKCA | P17252 | human | IGFBP1 | P08833 | S126 | GsPEsPEstEITEEE | |
PRKCA | P17252 | human | CELF1 | Q92879 | S302 | TSSGSsPsSSSSNSV | |
PRKCA | P17252 | human | FFAR4 | Q5NUL3-1 | S366 | GAILtDtsVKRNDLs | |
PRKCA | P17252 | human | KCNJ1 | P48048 | S4 | ____MNAsSRNVFDT | |
PRKCA | P17252 | human | IGFBP1 | P08833 | S123 | AEAGsPEsPEstEIT | |
PRKCA | P17252 | human | CASR | P41180 | T888 | FKVAARAtLRRsNVs | |
PRKCA | P17252 | human | DOCK8 | Q8NF50 | S2082 | VEsQKRDsFHRSsFR | |
PRKCA | P17252 | human | RELA | Q04206 | S536 | sGDEDFSsIADMDFS | |
PRKCA | P17252 | human | NOXO1 | Q8NFA2-3 | T341 | AIQSRCCtVTRRALE | |
PRKCA | P17252 | human | CHAT | P28329-3 | S440 | VPTYESAsIRRFQEG | Carn_acyltransf |
PRKCA | P17252 | human | PHB2 | Q99623 | S39 | VAyGVREsVFTVEGG | |
PRKCA | P17252 | human | FBXW7 | Q969H0 | S18 | KRRRTGGsLRGNPSs | |
PRKCA | P17252 | human | PLD2 | O14939 | T252 | LLYMCLEtGAISFVQ | |
PRKCA | P17252 | human | TBXA2R | P21731 | S331 | sTRPRsLsLQPQLtQ | |
PRKCA | P17252 | human | GRIN2B | Q13224 | S1415 | QPtVAGAsKARPDFR | NMDAR2_C |
PRKCA | P17252 | human | GRIK2 | Q13002 | S868 | MVEELRMsLKcQRRL | |
PRKCA | P17252 | human | LRP1 | Q07954 | T4460 | GFQHQRMtNGAMNVE | |
PRKCA | P17252 | human | NR1H4 | Q96RI1-2 | S154 | CKGFFRRsITKNAVY | zf-C4 |
PRKCA | P17252 | human | C5AR1 | P21730 | S332 | EEsVVREsKsFTRsT | |
PRKCA | P17252 | human | NLGN4X | Q8N0W4 | T707 | KDKRRHEtHRRPSPQ | |
PRKCA | P17252 | human | ARHGDIA | P52565 | S96 | DLTGDLEsFKkQsFV | Rho_GDI |
PRKCA | P17252 | human | HSPB1 | P04792 | S15 | FsLLrGPsWDPFrDW | |
PRKCA | P17252 | human | ARRB1 | P49407 | S163 | EkIHKRNsVRLVIRK | Arrestin_N |
PRKCA | P17252 | human | TNNI3 | P19429 | S44 | KKskIsAsRKLQLKt | |
PRKCA | P17252 | human | LRP1 | Q07954 | S4517 | LyMGGHGsRHsLAsT | |
PRKCA | P17252 | human | TBXA2R | P21731 | S324 | RRLQPRLsTRPRsLs | |
PRKCA | P17252 | human | CHAT | P28329-3 | S347 | LKHVTQssRKLIRAD | Carn_acyltransf |
PRKCA | P17252 | human | CYP3A4 | P08684 | S116 | GPVGFMksAIsIAED | p450 |
PRKCA | P17252 | human | TBXA2R | P21731 | S329 | RLsTRPRsLsLQPQL | |
PRKCA | P17252 | human | DTNB | O60941 | T212 | MLNMFLDtMMADPPP | EF-hand_3 |
PRKCA | P17252 | human | CSNK1D | P48730 | S298 | NMLKFGAsRAADDAE | |
PRKCA | P17252 | human | CORO1A | P31146 | T412 | RVNRGLDtGRRRAAP | Trimer_CC |
PRKCA | P17252 | human | CHAT | P28329-3 | T255 | TVLVKDStNRDSLDM | Carn_acyltransf |
PRKCA | P17252 | human | NCF1 | P14598 | S370 | PAVPPRPsADLILNR | p47_phox_C |
PRKCA | P17252 | human | NPHS1 | O60500 | T1125 | QWtGERDtQSSTVST | |
PRKCA | P17252 | human | PFKFB3 | Q16875 | S461 | NPLMRRNsVtPLAsP | |
PRKCA | P17252 | human | RRAD | P55042 | S299 | KMAFRAKsKsCHDLS | |
PRKCA | P17252 | human | EIF2S3 | P41091 | T66 | kAISGVHtVRFkNEL | GTP_EFTU |
PRKCA | P17252 | human | CYP3A4 | P08684 | T284 | DSQNSkEtESHKALS | p450 |
PRKCA | P17252 | human | ITGB2 | P05107 | T760 | LFksAtttVMNPkFA | Integrin_b_cyt |
PRKCA | P17252 | human | KCNMA1 | Q12791 | S1200 | SHSsQSSsKKSSsVH | |
PRKCA | P17252 | human | ITGB4 | P16144 | S1364 | PSGsQRPsVSDDTGC | |
PRKCA | P17252 | human | TRPV1 | Q8NER1 | S502 | YFLQRRPsMKTLFVD | Ion_trans |
PRKCA | P17252 | human | PTPN22 | Q9Y2R2 | S751 | kSFtRSKsLKILRNM | |
PRKCA | P17252 | human | MAPT | P10636-8 | S293 | NVQskCGsKDNIkHV | Tubulin-binding |
PRKCA | P17252 | human | CYP2E1 | P05181 | S431 | sDYFkPFstGkRVCA | p450 |
PRKCA | P17252 | human | TRPM2 | O94759-3 | S39 | NLRRSNSsLFKSWRL | |
PRKCA | P17252 | human | CELF1 | Q92879 | S300 | VLTSSGSsPsSSSSN | |
PRKCA | P17252 | human | SH2B1 | Q9NRF2 | S165 | VGRsVRGsVRGILQW | |
PRKCA | P17252 | human | TBXA2R | P21731 | T337 | LsLQPQLtQRSGLQ_ | |
PRKCA | P17252 | human | PPP1R1A | Q13522 | T75 | PRQRKKMtRItPTMK | DARPP-32 |
PRKCA | P17252 | human | TNNI3 | P19429 | S42 | AKKKskIsAsRKLQL | |
PRKCA | P17252 | human | BCL11B | Q9C0K0 | S2 | ______MsRRKQGNP | |
PRKCA | P17252 | human | KIT | P10721 | S746 | RRsVRIGsyIERDVT | PK_Tyr_Ser-Thr |
PRKCA | P17252 | human | NCF1 | P14598 | S304 | GAPPRRssIRNAHsI | NECFESHC |
PRKCA | P17252 | human | AQP1 | P29972 | T239 | APRSsDLtDRVKVWT | |
PRKCA | P17252 | human | C5AR1 | P21730 | S327 | RNVLtEEsVVREsKs | |
PRKCA | P17252 | human | BNC1 | Q01954 | S541 | KKksRKSsMPIkIEK | |
PRKCA | P17252 | human | LRRK1 | Q38SD2 | S1064 | NRKVTIysFTGNQRN | |
PRKCA | P17252 | human | HRH1 | P35367 | S396 | FTWKRLRsHsRQyVS | 7tm_1 |
PRKCA | P17252 | human | MMP2 | P08253 | S160 | DVTPLRFsRIHDGEA | Peptidase_M10 |
PRKCA | P17252 | human | KRT20 | P35900 | S13 | RSFHRsLsSSLQAPV | |
PRKCA | P17252 | human | TUBA1A | Q71U36 | S165 | sVDyGkkskLEFSIy | Tubulin |
PRKCA | P17252 | human | RORA | P35398 | S100 | CKGFFRRsQQSNATY | zf-C4 |
PRKCA | P17252 | human | PRKD2 | Q9BZL6 | S706 | ARIIGEksFRRsVVG | Pkinase |
PRKCA | P17252 | human | PRKD1 | Q15139 | S412 | PLMRVVQsVKHTKRK | |
PRKCA | P17252 | human | PRKD2 | Q9BZL6 | S710 | GEksFRRsVVGtPAy | Pkinase |
PRKCA | P17252 | human | PLEK | P08567 | S117 | ARKstRRsIRLPEtI | |
PRKCA | P17252 | human | EWSR1 | Q01844 | S266 | SSYGQQSsFRQDHPS | |
PRKCA | P17252 | human | CD226 | Q15762 | S329 | yVNyPTFsRRPKTRV | |
PRKCA | P17252 | human | GSK3A | P49840 | S21 | sGrARtssFAEPGGG | |
PRKCA | P17252 | human | SLC6A3 | Q01959 | S12 | kCsVGLMssVVAPAK | |
PRKCA | P17252 | human | ARX | Q96QS3 | S174 | VSISRSKsYRENGAP | |
PRKCA | P17252 | human | ZFP64 | Q9NTW7 | S226 | NKHLRIHsDERPFKC | zf-H2C2_5 |
PRKCA | P17252 | human | ARHGAP35 | Q9NRY4 | S1221 | RRRNILRsLRRNtKK | RhoGAP_pG1_pG2 |
PRKCA | P17252 | human | ANXA2 | P07355 | S12 | HEILCkLsLEGDHst | |
PRKCA | P17252 | human | ADRA1D | P25100 | S300 | KRERGKAsEVVLRIH | 7tm_1 |
PRKCA | P17252 | human | RAB37 | Q96AX2 | T172 | YGVPFLEtSAKTGMN | Ras |
PRKCA | P17252 | human | NCF1 | P14598 | S379 | DLILNRCsEstKRKL | p47_phox_C |
PRKCA | P17252 | human | FRAT1 | Q92837 | S188 | RLQQRRGsQPETRTG | GSK-3_bind |
PRKCA | P17252 | human | LRRK1 | Q38SD2 | T1075 | NQRNRCstFRVKRNQ | |
PRKCA | P17252 | human | MYL9 | P24844 | S3 | _____MssKRAKAKt | |
PRKCA | P17252 | human | APLP2 | Q06481 | T723 | LRKRQYGtISHGIVE | APP_amyloid |
PRKCA | P17252 | human | GHSR | Q92847 | T261 | RDQNHKQtVKMLAVV | 7tm_1 |
PRKCA | P17252 | human | HRH1 | P35367 | T478 | CNENFKKtFKRILHI | |
PRKCA | P17252 | human | MARCKS | P29966 | S159 | kkKKKRFsFkKsFkL | MARCKS |
PRKCA | P17252 | human | CELF1 | Q92879 | S241 | LLQQTASsGNLNTLS | |
PRKCA | P17252 | human | CYP2E1 | P05181 | S129 | WKDIRRFsLttLRNY | p450 |
PRKCA | P17252 | human | NOX5 | Q96PH1-4 | S498 | RSVtMRKsQRSsKGS | FAD_binding_8 |
PRKCA | P17252 | human | TAGLN2 | P37802 | S185 | MGtNrGAsQAGMtGy | Calponin |
PRKCA | P17252 | human | BEST1 | O76090 | S358 | SAQFRRAsFMGSTFN | |
PRKCA | P17252 | human | ITGB4 | P16144 | S1360 | VLRsPSGsQRPsVSD | |
PRKCA | P17252 | human | TRPV1 | Q8NER1 | S801 | VPLLREAsARDRQsA | |
PRKCA | P17252 | human | CYP3A4 | P08684 | T92 | TDPDMIKtVLVKECY | p450 |
PRKCA | P17252 | human | MYL9 | P24844 | T10 | sKRAKAKttKKRPQR | |
PRKCA | P17252 | human | CYP2E1 | P05181 | T58 | KNIPKsFtRLAQRFG | p450 |
PRKCA | P17252 | human | DTNB | O60941 | T179 | KEVLKLPtAVFEGPS | EF-hand_3 |
PRKCA | P17252 | human | APPL1 | Q9UKG1 | S430 | ARTSssGsLGSESTN | |
PRKCA | P17252 | human | ERBB2 | P04626 | T686 | QQKIRKYtMRRLLQE | |
PRKCA | P17252 | human | CLDN4 | O14493 | S194 | PRTDKPysAKysAAR | |
PRKCA | P17252 | human | MMP2 | P08253 | T378 | GKMWCAttANYDDDR | Peptidase_M10; fn2 |
PRKCA | P17252 | human | LRP1 | Q07954 | S4520 | GGHGsRHsLAsTDEk | |
PRKCA | P17252 | human | TNNI3 | P19429 | S199 | RkNIDALsGMEGRKK | |
PRKCA | P17252 | human | ABCB1 | P08183 | S661 | SSNDSRSsLIRKRsT | |
PRKCA | P17252 | human | NR1H4 | Q96RI1-2 | S135 | VVCGDRAsGYHYNAL | zf-C4 |
PRKCA | P17252 | human | MBD4 | O95243 | S262 | sGFVQSDsKRESVCN | |
PRKCA | P17252 | human | KCNJ1 | P48048 | S201 | FSKNAVIskRGGKLC | IRK_C |
PRKCA | P17252 | human | MAPT | P10636-8 | S258 | PDLkNVKskIGstEN | Tubulin-binding |
PRKCA | P17252 | human | ABCB1 | P08183 | S667 | SsLIRKRsTRRsVRG | |
PRKCA | P17252 | human | CFL1 | P23528 | S24 | DMkVRksstPEEVkk | Cofilin_ADF |
PRKCA | P17252 | human | NHERF1 | O14745 | S162 | CtMKKGPsGyGFNLH | PDZ |
PRKCA | P17252 | human | TP53 | P04637 | T377 | kskkGQstsRHkkLM | |
PRKCA | P17252 | human | PANX1 | Q96RD7 | Y199 | KYPIVEQyLkTkkNS | Innexin |
PRKCA | P17252 | human | SNAP25 | P60880 | S187 | RIMEKADsNKTRIDE | |
PRKCA | P17252 | human | ANXA1 | P04083 | S27 | EyVQtVksskGGPGs | |
PRKCA | P17252 | human | DOCK8 | Q8NF50 | S2087 | RDsFHRSsFRKCETQ | |
PRKCA | P17252 | human | RALBP1 | Q15311 | S353 | LSPTVQIsNRVLYVF | RhoGAP |
PRKCA | P17252 | human | CYP3A4 | P08684 | S139 | LLsPtFTsGKLKEMV | p450 |
PRKCA | P17252 | human | PAK5 | Q9P286 | S99 | ISVTRSNsLRKESPP | |
PRKCA | P17252 | human | CYTH2 | Q99418 | S392 | AARKKRIsVKKKQEQ | |
PRKCA | P17252 | human | ATF2 | P15336 | S121 | LAtPIIRsKIEEPSV | |
PRKCA | P17252 | human | CTNND1 | O60716 | S879 | LIDRNQksDkkPDRE | |
PRKCA | P17252 | human | MBD4 | O95243 | S165 | CSMAALTsHLQNQSN | |
PRKCA | P17252 | human | CYP2E1 | P05181 | S74 | VFtLYVGsQRMVVMH | p450 |
PRKCA | P17252 | human | KIR3DL1 | P43629 | S415 | QRKITRPsQRPKtPP | |
PRKCA | P17252 | human | MARCKS | P29966 | S167 | FkKsFkLsGFsFkKN | MARCKS |
PRKCA | P17252 | human | PDE3A | Q14432 | S292 | VFkRRRRsssVVsAE | |
PRKCA | P17252 | human | CD36 | P16671 | T92 | VKQRGPYtYRVRFLA | CD36 |
PRKCA | P17252 | human | TP53 | P04637 | S371 | AHssHLkskkGQsts | |
PRKCA | P17252 | human | TTN | Q8WZ42 | S12022 | RRKLRPGsGGEKPPD | |
PRKCA | P17252 | human | GSK3B | P49841 | S9 | SGRPRttsFAEsCkP | |
PRKCA | P17252 | human | LRRK1 | Q38SD2 | S1074 | GNQRNRCstFRVKRN | |
PRKCA | P17252 | human | FXYD1 | O00168 | S88 | RssIRRLstRRR___ | |
PRKCA | P17252 | human | FSCN1 | Q16658 | S39 | KVNASAssLkkkQIW | Fascin |
PRKCA | P17252 | human | VTN | P04004 | S386 | YRsQRGHsRGRNQNs | |
PRKCA | P17252 | human | ELAVL1 | Q15717 | S221 | QAQrFrFsPMGVDHM | |
PRKCA | P17252 | human | TACSTD2 | P09758 | S322 | GELRkEPsL______ | |
PRKCA | P17252 | human | RALBP1 | Q15311 | S509 | FLRRQIAsEKEEIER | |
PRKCA | P17252 | human | PA2G4 | Q9UQ80 | S360 | ELkALLQssAsRKtQ | |
PRKCA | P17252 | human | NF1 | P21359-2 | S2808 | QKQRSAGsFKRNsIK | |
PRKCA | P17252 | human | PEBP1 | P30086 | S153 | RGKFkVAsFRKKYEL | PBP |
PRKCA | P17252 | human | DNM1 | Q05193 | S778 | GRRsPtssPtPQRRA | |
PRKCA | P17252 | human | RAF1 | P04049 | S499 | VksRWsGsQQVEQPT | PK_Tyr_Ser-Thr |
PRKCA | P17252 | human | C5AR1 | P21730 | S338 | EsKsFTRsTVDTMAQ | |
PRKCA | P17252 | human | PRKD3 | O94806 | S731 | ARIIGEksFRRsVVG | Pkinase |
PRKCA | P17252 | human | AR | P10275 | S579 | YGALTCGsCKVFFKR | zf-C4 |
PRKCA | P17252 | human | PDE3A | Q14432 | S428 | IPKRLRRsLPPGLLR | |
PRKCA | P17252 | human | CYP2E1 | P05181 | T132 | IRRFsLttLRNYGMG | p450 |
PRKCA | P17252 | human | BCL2 | P10415 | S70 | RDPVARtsPLQtPAA | |
PRKCA | P17252 | human | CELF1 | Q92879 | S52 | INVLRDRsQNPPQSk | RRM_1 |
PRKCA | P17252 | human | PACSIN2 | Q9UNF0 | S313 | ADLNRtLsRREKKKA | |
PRKCA | P17252 | human | F11R | Q9Y624 | S284 | kVIysQPsARsEGEF | |
PRKCA | P17252 | human | ABCB1 | P08183 | S671 | RKRsTRRsVRGsQAQ | |
PRKCA | P17252 | human | ADRA1D | P25100 | S323 | DGAHGMRsAKGHtFR | 7tm_1 |
PRKCA | P17252 | human | CYP3A4 | P08684 | T136 | LRsLLsPtFTsGKLK | p450 |
PRKCA | P17252 | human | RPS6KB2 | Q9UBS0 | S473 | PPSGTKKsKRGRGRP | |
PRKCA | P17252 | human | SATB1 | Q01826 | S185 | DLPPEQWsHTtVRNA | CUTL |
PRKCA | P17252 | human | CD4 | P01730 | S433 | RRQAERMsQIkRLLs | Tcell_CD4_C |
PRKCA | P17252 | human | PTPN12 | Q05209 | S39 | FMRLRRLstKYRTEK | |
PRKCA | P17252 | human | ACO1 | P21399 | S711 | REFNSYGsRrGNDAV | Aconitase_C |
PRKCA | P17252 | human | TBXA2R | P21731 | S145 | FSRPAVAsQRRAWAT | 7tm_1 |
PRKCA | P17252 | human | SNAP25 | P60880 | T138 | GGFIRRVtNDARENE | SNAP-25 |
PRKCA | P17252 | human | INSR | P06213 | S1064 | kTVNEsAsLRERIEF | PK_Tyr_Ser-Thr |
PRKCA | P17252 | human | RAF1 | P04049 | S43 | FGyQRRAsDDGKLtD | |
PRKCA | P17252 | human | FMNL2 | Q96PY5-3 | S1072 | RADAVRRsVRRRFDD | |
PRKCA | P17252 | human | RORA | P35398 | S35 | ETPLNQEsArKSEPP | |
PRKCA | P17252 | human | SLC18A2 | Q05940 | S18 | WLQEsRRsRKLILFI | |
PRKCA | P17252 | human | MMP2 | P08253 | S365 | NKyEsCtsAGRsDGK | Peptidase_M10; fn2 |
PRKCA | P17252 | human | SH2B1 | Q9NRF2 | S161 | sLRsVGRsVRGsVRG | |
PRKCA | P17252 | human | RIGI | O95786 | S8 | MTTEQRRsLQAFQDY | CARD_2 |
PRKCA | P17252 | human | PA2G4 | Q9UQ80 | T366 | QssAsRKtQKKKKKk | |
PRKCA | P17252 | human | RET | P07949 | T675 | PISSAEMtFRRPAQA | |
PRKCA | P17252 | human | CYSLTR1 | Q9Y271 | S316 | FRKHsLssVTYVPRK | |
PRKCA | P17252 | human | CFLAR | O15519-2 | S193 | LQAAIQKsLKDPSNN | |
PRKCA | P17252 | human | GRK2 | P25098 | S29 | ATPAARAskkILLPE | |
PRKCA | P17252 | human | VIM | P08670 | S10 | trsVssssyrrMFGG | Filament_head |
PRKCA | P17252 | human | PITPNC1 | Q9UKF7 | S299 | KDRPRKKsAPEtLtL | |
PRKCA | P17252 | human | C5AR1 | P21730 | S334 | sVVREsKsFTRsTVD | |
PRKCA | P17252 | human | VIM | P08670 | S5 | ___MStrsVssssyr | |
PRKCA | P17252 | human | EIF4G1 | Q04637 | S1185 | RtPATKRsFskEVEE | |
PRKCA | P17252 | human | TRPC3 | Q13507 | S785 | PPFsLVPsPKsFVyF | |
PRKCA | P17252 | human | NHERF1 | O14745 | S77 | ETHQQVVsRIRAALN | PDZ |
PRKCA | P17252 | human | KCNC4 | Q03721 | S15 | ssYRGRKsGNKPPsK | Potassium_chann |
PRKCA | P17252 | human | CLDN1 | O95832 | T191 | CSCPRkTtsYPtPRP | |
PRKCA | P17252 | human | CTPS1 | P17812 | S462 | tLFQTkNsVMRkLYG | GATase |
PRKCA | P17252 | human | TGFBR1 | P36897 | T200 | LPLLVQRtIARtIVL | TGF_beta_GS |
PRKCA | P17252 | human | IQGAP1 | P46940 | S1443 | DKMKKsksVkEDsNL | |
PRKCA | P17252 | human | NR2F6 | P10588 | S83 | CKSFFKRsIRRNLsY | zf-C4 |
PRKCA | P17252 | human | KLHL3 | Q9UH77 | S433 | PMNTRRSsVGVGVVE | Kelch_1 |
PRKCA | P17252 | human | TBXA2R | P21731-2 | T399 | LLPFEPPtGKALSRK | |
PRKCA | P17252 | human | PPP1R1A | Q13522 | S67 | LKSTLAMsPRQRKKM | DARPP-32 |
PRKCA | P17252 | human | CSNK1D | P48730 | T161 | KKYRDARtHQHIPYR | Pkinase |
PRKCA | P17252 | human | ELAVL1 | Q15717 | S158 | FIRFDKRsEAEEAIT | RRM_1 |
PRKCA | P17252 | human | PRKD1 | Q15139 | S738 | ARIIGEksFRRsVVG | Pkinase |
PRKCA | P17252 | human | GJA1 | P17302 | S372 | sRAssRAssRPRPDD | |
PRKCA | P17252 | human | ARHGAP35 | Q9NRY4 | T1226 | LRsLRRNtKKPKPKP | RhoGAP_pG1_pG2 |
PRKCA | P17252 | human | ELAVL1 | Q15717 | S318 | GDkILQVsFkTNkSH | |
PRKCA | P17252 | human | PDE3A | Q14432 | S312 | SKSHRRTsLPCIPRE | |
PRKCA | P17252 | human | KIT | P10721 | S741 | TkADkRRsVRIGsyI | PK_Tyr_Ser-Thr |
PRKCA | P17252 | human | CORO1B | Q9BR76 | S2 | ______MsFRKVVRQ | |
PRKCA | P17252 | human | CFTR | P13569 | S660 | FSAERRNsILTETLH | CFTR_R |
PRKCA | P17252 | human | KCNJ13 | O60928 | S201 | TRPSPLTsVRVSAVL | IRK_C |
PRKCA | P17252 | human | CLDN7 | O95471 | S204 | VPRsYPksNsskEyV | |
PRKCA | P17252 | human | PDE3A | Q14432 | S438 | PGLLRRVsstWtttt | |
PRKCA | P17252 | human | KRAS | P01116-2 | S181 | GKKKKkKskTkCVIM | |
PRKCA | P17252 | human | PDE3A | Q14432 | S492 | MTLTkSRsFtSSyAI | |
PRKCA | P17252 | human | SHOC2 | Q9UQ13 | S297 | GLRYNRLsAIPRSLA | LRR_8 |
PRKCA | P17252 | human | NCF1 | P14598 | S315 | AHsIHQRsRKRLsQD | NECFESHC |
PRKCA | P17252 | human | CFTR | P13569 | S686 | WTEtKKQsFKQTGEF | CFTR_R |
PRKCA | P17252 | human | CYP3A4 | P08684 | S398 | GVVVMIPsYALHRDP | p450 |
PRKCA | P17252 | human | PTPN6 | P29350 | S591 | DKEKsKGsLKRK___ | |
PRKCA | P17252 | human | ADD2 | P35612 | S713 | KKKFRtPsFLKKsKK | |
PRKCA | P17252 | human | GNAZ | P19086 | S27 | DRHLRSEsQRQRREI | G-alpha |
PRKCA | P17252 | human | JAK2 | O60674 | T174 | kVPVTHEtQEECLGM | FERM_F2 |
PRKCA | P17252 | human | SLC6A4 | P31645 | S277 | IWKGVKtsGKVVWVT | SNF |
PRKCA | P17252 | human | NR1I3 | Q14994 | T38 | CKGFFRRtVSKSIGP | zf-C4 |
PRKCA | P17252 | human | AHR | P35869 | S12 | SANITYAsRKRRKPV | |
PRKCA | P17252 | human | KCNJ4 | P48050 | T53 | IFTTCVDtRWRYMLM | IRK |
PRKCA | P17252 | human | SPIC | Q8N5J4 | Y191 | KIRRKLTyQFSEAIL | Ets |
PRKCA | P17252 | human | ADD1 | P35611 | S726 | KKKFRtPsFLKKsKK | |
PRKCA | P17252 | human | CFLAR | O15519 | S193 | LQAAIQksLkDPSNN | |
PRKCA | P17252 | human | RGS7 | P49802 | S434 | YKLMKSDsYPRFIRS | RGS |
PRKCA | P17252 | human | KCNQ2 | O43526 | T217 | RMDRRGGtWKLLGSV | Ion_trans; TM |
PRKCA | P17252 | human | PDE3A | Q14432 | S465 | VRRDRsTsIkLQEAP | |
PRKCA | P17252 | human | PPARG | P37231 | T166 | CKGFFRRtIRLKLIY | |
PRKCA | P17252 | human | NOX5 | Q96PH1-4 | S490 | GRGSKRLsRSVtMRK | FAD_binding_8 |
PRKCA | P17252 | human | CYP3A4 | P08684 | S119 | GFMksAIsIAEDEEW | p450 |
PRKCA | P17252 | human | GPSM2 | P81274 | S408 | PKLGRRHsMENMELM | |
PRKCA | P17252 | human | PIM1 | P11309-2 | S65 | HSHSPRHsLRHSPGS | |
PRKCA | P17252 | human | NCF1 | P14598 | S328 | QDAYRRNsVRFLQQR | NECFESHC |
PRKCA | P17252 | human | RASSF1 | Q9NS23-2 | S197 | RGPGRGTsVRRRtsF | |
PRKCA | P17252 | human | NCF4 | Q15080 | T154 | LRRLRPRtRKVKSVs | |
PRKCA | P17252 | human | CYP3A4 | P08684 | S420 | kFLPERFsKKNKDNI | p450 |
PRKCA | P17252 | human | NKX3-1 | Q99801 | S48 | RQGGRTSsQRQRDPE | |
PRKCA | P17252 | human | TP53 | P04637 | S378 | skkGQstsRHkkLMF | |
PRKCA | P17252 | human | ROBO3 | Q96MS0 | S1330 | WLPYSRPsFLSrGQG | |
PRKCA | P17252 | human | CD5 | P06127 | T434 | MsFHRNHtAtVRsHA | |
PRKCA | P17252 | human | SLC6A3 | Q01959 | S7 | _MsKskCsVGLMssV | |
PRKCA | P17252 | human | TP73 | O15350 | S388 | VPQPLVDsYRQQQQL | |
PRKCA | P17252 | human | GNMT | Q14749 | S10 | DSVYRtRsLGVAAEG | |
PRKCA | P17252 | human | CHAT | P28329-3 | S476 | HKAAVPAsEKLLLLK | Carn_acyltransf |
PRKCA | P17252 | human | AFAP1 | Q8N556 | S277 | AELEKKLssERPssD | |
PRKCA | P17252 | human | PPP1R16B | Q96T49 | S331 | sQLRHKSsLsRRTsS | |
PRKCA | P17252 | human | VDR | P11473 | S51 | CKGFFRRsMKRKALF | zf-C4 |
PRKCA | P17252 | human | MMP2 | P08253 | T250 | EYNsCTDtGRSDGFL | Peptidase_M10; fn2 |
PRKCA | P17252 | human | F3 | P13726 | S290 | GQsWkENsPLNVs__ | |
PRKCA | P17252 | human | MYL9 | P24844 | S2 | ______MssKRAKAK | |
PRKCA | P17252 | human | GJA1 | P17302 | S368 | QRPssRAssRAssRP | |
PRKCA | P17252 | human | CYP2E1 | P05181 | T373 | SNLPHEAtRDtIFrG | p450 |
PRKCA | P17252 | human | ADRA1D | P25100 | S516 | QLRAKVssLsHKIRA | |
PRKCA | P17252 | human | KCNK9 | Q9NPC2 | T341 | IEEISPStLKNSLFP | |
PRKCA | P17252 | human | CELF1 | Q92879 | S178 | AQtMEGCssPMVVkF | RRM_1 |
PRKCA | P17252 | human | CYP3A4 | P08684 | S134 | kRLRsLLsPtFTsGK | p450 |
PRKCA | P17252 | human | CYP2E1 | P05181 | T131 | DIRRFsLttLRNYGM | p450 |
PRKCA | P17252 | human | DLG1 | Q12959 | T657 | KERARLKtVkFNsKT | |
PRKCA | P17252 | human | CHAT | P28329-3 | S346 | LLKHVTQssRKLIRA | Carn_acyltransf |
PRKCA | P17252 | human | CFTR | P13569 | S795 | TAsTRKVsLAPQANL | CFTR_R |
PRKCA | P17252 | human | H3C1 | P68431 | T6 | __ArtkQtArkstGG | Histone |
PRKCA | P17252 | human | CSNK1D | P48730 | S191 | THLGIEQsRRDDLES | Pkinase |
PRKCA | P17252 | human | SCN9A | Q15858-3 | I848 | LNMLIKIiGNSVGAL | Ion_trans |
PRKCA | P17252 | human | EGLN2 | Q96KS0 | S234 | QRAIPPRsIRGDQIA | |
PRKCA | P17252 | human | CD44 | P16070 | S672 | AVCIAVNsRRRCGQK | |
PRKCA | P17252 | human | CYP3A4 | P08684 | T103 | KECYsVFtNRRPFGP | p450 |
PRKCA | P17252 | human | HABP4 | Q5JVS0 | T375 | GRGARGGtRGGRGRI | IHABP4_N |
PRKCA | P17252 | human | PRKD2 | Q9BZL6 | S876 | QGLAERIsVL_____ | |
PRKCA | P17252 | human | TXN | P10599 | T100 | NkEkLEAtINELV__ | Thioredoxin |
PRKCA | P17252 | human | GSTA4 | O15217 | T193 | VKLsNIPtIKRFLEP | GST_C_3 |
PRKCA | P17252 | human | TNNT2 | P45379 | S189 | ARKKKALsNMMHFGG | Troponin |
PRKCA | P17252 | human | PPP1R14B | Q96C90 | T57 | VRRQGKVtVkYDRKE | PP1_inhibitor |
PRKCA | P17252 | human | FERMT3 | Q86UX7 | S484 | LSLQRtGsGGPGNHP | FERM_M |
PRKCA | P17252 | human | TRPV5 | Q9NQA5 | S654 | yVEVFKNsDKEDDQE | |
PRKCA | P17252 | human | VTN | P04004 | S381 | RNRKGYRsQRGHsRG | |
PRKCA | P17252 | human | EP300 | Q09472 | S89 | SELLRSGsSPNLNMG | |
PRKCA | P17252 | human | IKBKB | O14920 | S177 | AkELDQGsLCtsFVG | Pkinase |
PRKCA | P17252 | human | ICOSLG | O75144 | S285 | RDRCLQHsYAGAWAV | |
PRKCA | P17252 | human | TUBA1C | Q9BQE3 | S158 | sLLMERLsVDyGkks | Tubulin |
PRKCA | P17252 | human | C5AR1 | P21730 | S317 | RLRKsLPsLLRNVLt | |
PRKCA | P17252 | human | IL2RA | P01589 | T271 | RQRKsRRtI______ | |
PRKCA | P17252 | human | CYP2E1 | P05181 | T432 | DYFkPFstGkRVCAG | p450 |
PRKCA | P17252 | human | CSNK1D | P48730 | T176 | ENkNLtGtARYAsIN | Pkinase |
PRKCA | P17252 | human | PLEK | P08567 | S113 | GQKFARKstRRsIRL | |
PRKCA | P17252 | human | ADRA1D | P25100 | S518 | RAKVssLsHKIRAGG | |
PRKCA | P17252 | human | DOCK8 | Q8NF50 | S2077 | KPIFRVEsQKRDsFH | |
PRKCA | P17252 | human | HDAC5 | Q9UQL6 | S259 | FPLRkTAsEPNLKVR | |
PRKCA | P17252 | human | FFAR4 | Q5NUL3-1 | T363 | PEKGAILtDtsVKRN | |
PRKCA | P17252 | human | SHOC2 | Q9UQ13 | T71 | VAFSVDNtIKRPNPA | |
PRKCA | P17252 | human | TRPM4 | Q8TD43 | S1145 | RDKRESDsERLKRTs | |
PRKCA | P17252 | human | VIM | P08670 | S7 | _MStrsVssssyrrM | Filament_head |
PRKCA | P17252 | human | XRCC6 | P12956 | S78 | YISKIIssDRDLLAV | Ku_N |
PRKCA | P17252 | human | ACO1 | P21399 | S138 | DFNRRADsLQkNQDL | Aconitase |
PRKCA | P17252 | human | H2BC3 | P33778 | S32 | DGKkRKRsRkEsysI | Histone |
PRKCA | P17252 | human | CYP2E1 | P05181 | S145 | MGKQGNEsRIQREAH | p450 |
PRKCA | P17252 | human | AHR | P35869 | S36 | EGIkSNPsKRHRDRL | HLH |
PRKCA | P17252 | human | PRKCE | Q02156 | S368 | NNIRKALsFDNRGEE | |
PRKCA | P17252 | human | MARCKS | P29966 | S170 | sFkLsGFsFkKNKkE | MARCKS |
PRKCA | P17252 | human | CD3G | P09693 | S148 | GVRQsRAsDkQTLLP | |
PRKCA | P17252 | human | NCF1 | P14598 | S303 | RGAPPRRssIRNAHs | NECFESHC |
PRKCA | P17252 | human | FFAR4 | Q5NUL3-1 | S373 | sVKRNDLsIIsG___ | |
PRKCA | P17252 | human | CD300LF | Q8TDQ1 | T221 | GTsPQKAtTKLSSAQ | SIT |
PRKCA | P17252 | human | IKBKB | O14920 | S181 | DQGsLCtsFVGTLQy | Pkinase |
PRKCA | P17252 | human | ILK | Q13418 | T181 | RTRPRNGtLNkHsGI | |
PRKCA | P17252 | human | THOC5 | Q13769 | S5 | ___MSSEssKKRKPK | |
PRKCA | P17252 | human | F3 | P13726 | S285 | RKAGVGQsWkENsPL | |
PRKCA | P17252 | human | TAGLN2 | P37802 | T180 | VIGLQMGtNrGAsQA | Calponin |
PRKCA | P17252 | human | PTGIR | P43119 | S328 | TPLSQLAsGRRDPRA | |
PRKCA | P17252 | human | TAGLN2 | P37802 | S11 | rGPAyGLsREVQQkI | |
PRKCA | P17252 | human | NOXO1 | Q8NFA2-3 | S154 | SRAAGRLsIHSLEAQ | |
PRKCA | P17252 | human | ILK | Q13418 | T173 | DTFWkGttRTRPRNG | |
PRKCA | P17252 | human | CYP3A4 | P08684 | S259 | SVKRMKEsRLEDtQK | p450 |
PRKCA | P17252 | human | GSTP1 | P09211 | S185 | SAYVGRLsARPkLkA | GST_C_3 |
PRKCA | P17252 | human | PRKD1 | Q15139 | S742 | GEksFRRsVVGtPAy | Pkinase |
PRKCA | P17252 | human | HABP4 | Q5JVS0 | T354 | RKPANDItSQLEINF | IHABP4_N |
PRKCA | P17252 | human | PLCB3 | Q01970 | S1105 | LDRKRHNsIsEAKMR | PLC-beta_C |
PRKCA | P17252 | human | EPB41 | P11171-4 | S331 | RTASKRAsRSLDGAA | FA |
PRKCA | P17252 | human | CD5 | P06127 | T436 | FHRNHtAtVRsHAEN | |
PRKCA | P17252 | human | TAGLN | Q01995 | S181 | VIGLQMGsNrGAsQA | Calponin |
PRKCA | P17252 | human | PLD2 | O14939 | S243 | RWLVVKDsFLLYMCL | |
PRKCA | P17252 | human | CYBA | P13498 | T147 | ERPQIGGtIkQPPsN | Cytochrom_B558a |
PRKCA | P17252 | human | SUN1 | O94901 | S55 | sPRMsRRsLRLATTA | |
PRKCA | P17252 | human | ADD1 | P35611 | S716 | GsPGKsPsKKKKKFR | |
PRKCA | P17252 | human | CFTR | P13569 | S641 | QNLQPDFsSKLMGCD | CFTR_R |
PRKCA | P17252 | human | RASSF1 | Q9NS23-2 | S203 | TsVRRRtsFYLPKDA | RA |
PRKCA | P17252 | human | NCF1 | P14598 | S359 | EERQtQRsKPQPAVP | p47_phox_C |
PRKCA | P17252 | human | VASP | P50552 | S157 | EHIERRVsNAGGPPA | |
PRKCA | P17252 | human | CYP2E1 | P05181 | T376 | PHEAtRDtIFrGYLI | p450 |
PRKCA | P17252 | human | TTN | Q8WZ42 | S11878 | KEEVVLKsVLRKRPE | |
PRKCA | P17252 | human | BDKRB2 | P30411 | S373 | sMGTLRTsIsVERQI | |
PRKCA | P17252 | human | NPHS1 | O60500 | T1120 | EYEESQWtGERDtQS | |
PRKCA | P17252 | human | SCN5A | Q14524 | S1503 | NAMKKLGsKKPQKPI | |
PRKCA | P17252 | human | CFTR | P13569 | S813 | DIYsRRLsQEtGLEI | CFTR_R |
PRKCA | P17252 | human | NMNAT1 | Q9HAN9 | S136 | WTETQDSsQKKSLEP | CTP_transf_like |
PRKCA | P17252 | human | THOC5 | Q13769 | S6 | __MSSEssKKRKPKV | |
PRKCA | P17252 | human | CYP2E1 | P05181 | T121 | IIFNNGPtWKDIRRF | p450 |
PRKCA | P17252 | human | GRIA1 | P42261 | S834 | EFcYKsRsEsKRMKG | |
PRKCA | P17252 | human | DRD2 | P14416 | S229 | RVNtkRssRAFRAHL | 7tm_1 |
PRKCA | P17252 | human | TNNI3 | P19429 | S24 | APIRRRssNyRAyAt | Troponin-I_N |
PRKCA | P17252 | human | RALBP1 | Q15311 | T297 | ACGRTTEtEkVQEFQ | RhoGAP |
PRKCA | P17252 | human | DTNB | O60941 | T69 | FRDNGLNtLDHTTEI | EF-hand_2 |
PRKCA | P17252 | human | IGFBP1 | P08833 | S194 | LAKAQETsGEEIsKF | Thyroglobulin_1 |
PRKCA | P17252 | human | GPR15 | P49685 | S357 | FARRRKRsVsL____ | |
PRKCA | P17252 | human | DRD2 | P14416 | S228 | kRVNtkRssRAFRAH | 7tm_1 |
PRKCA | P17252 | human | MET | P08581 | S985 | PHLDRLVsARsVsPt | |
PRKCA | P17252 | human | GRIA1 | P42261 | S849 | FCLIPQQsINEAIRT | |
PRKCA | P17252 | human | TWIST1 | Q15672 | S144 | tLPSDkLskIQTLkL | HLH |
PRKCA | P17252 | human | MAPT | P10636-8 | S305 | kHVPGGGsVQIVykP | Tubulin-binding |
PRKCA | P17252 | human | KCNA5 | P22460 | T15 | LENGGAMtVRGGDEA | |
PRKCA | P17252 | human | AKT1 | P31749 | T308 | kDGAtMKtFCGtPEy | Pkinase |
PRKCA | P17252 | human | ITGB4 | P16144 | S1494 | tLtRDyNsLtRsEHs |
Biological Network Integration of This Kinase and Substrates (GeneMANIA website) |
Enriched GO biological processes of the phosphorylation target genes of the kinase |
Kinase | GOID | GO term | P.adjust |
PRKCA | ID | Description | 0.00e+00 |
PRKCA | GO:0042060 | wound healing | 2.48e-16 |
PRKCA | GO:0009410 | response to xenobiotic stimulus | 5.28e-12 |
PRKCA | GO:0001667 | ameboidal-type cell migration | 5.28e-12 |
PRKCA | GO:0050878 | regulation of body fluid levels | 5.72e-12 |
PRKCA | GO:0050673 | epithelial cell proliferation | 5.72e-12 |
PRKCA | GO:0036293 | response to decreased oxygen levels | 5.72e-12 |
PRKCA | GO:0070482 | response to oxygen levels | 5.84e-12 |
PRKCA | GO:0034765 | regulation of monoatomic ion transmembrane transport | 3.23e-11 |
PRKCA | GO:0001666 | response to hypoxia | 5.67e-11 |
PRKCA | GO:0003012 | muscle system process | 1.36e-10 |
PRKCA | GO:0050678 | regulation of epithelial cell proliferation | 2.93e-10 |
PRKCA | GO:0006816 | calcium ion transport | 4.36e-10 |
PRKCA | GO:0010038 | response to metal ion | 4.54e-10 |
PRKCA | GO:0043491 | phosphatidylinositol 3-kinase/protein kinase B signal transduction | 9.65e-10 |
PRKCA | GO:0007015 | actin filament organization | 9.65e-10 |
PRKCA | GO:1901653 | cellular response to peptide | 9.65e-10 |
PRKCA | GO:0018105 | peptidyl-serine phosphorylation | 1.24e-09 |
PRKCA | GO:0030522 | intracellular receptor signaling pathway | 1.38e-09 |
PRKCA | GO:0048732 | gland development | 1.38e-09 |
PRKCA | GO:0097553 | calcium ion transmembrane import into cytosol | 2.51e-09 |
PRKCA | GO:0018209 | peptidyl-serine modification | 2.51e-09 |
PRKCA | GO:1902074 | response to salt | 2.59e-09 |
PRKCA | GO:1903522 | regulation of blood circulation | 2.93e-09 |
PRKCA | GO:0070372 | regulation of ERK1 and ERK2 cascade | 3.08e-09 |
PRKCA | GO:0043410 | positive regulation of MAPK cascade | 5.42e-09 |
PRKCA | GO:0031623 | receptor internalization | 5.56e-09 |
PRKCA | GO:1903829 | positive regulation of protein localization | 5.56e-09 |
PRKCA | GO:0007596 | blood coagulation | 9.11e-09 |
PRKCA | GO:0070371 | ERK1 and ERK2 cascade | 1.12e-08 |
PRKCA | GO:0010959 | regulation of metal ion transport | 1.21e-08 |
PRKCA | GO:0050817 | coagulation | 1.23e-08 |
PRKCA | GO:0036294 | cellular response to decreased oxygen levels | 1.23e-08 |
PRKCA | GO:1904375 | regulation of protein localization to cell periphery | 1.25e-08 |
PRKCA | GO:0007265 | Ras protein signal transduction | 1.27e-08 |
PRKCA | GO:0007599 | hemostasis | 1.27e-08 |
PRKCA | GO:0010631 | epithelial cell migration | 1.31e-08 |
PRKCA | GO:0090132 | epithelium migration | 1.51e-08 |
PRKCA | GO:0071496 | cellular response to external stimulus | 1.56e-08 |
PRKCA | GO:0051098 | regulation of binding | 1.62e-08 |
PRKCA | GO:0090130 | tissue migration | 1.85e-08 |
PRKCA | GO:0048511 | rhythmic process | 2.37e-08 |
PRKCA | GO:0045785 | positive regulation of cell adhesion | 2.38e-08 |
PRKCA | GO:0003018 | vascular process in circulatory system | 2.40e-08 |
PRKCA | GO:0007159 | leukocyte cell-cell adhesion | 2.48e-08 |
PRKCA | GO:0043254 | regulation of protein-containing complex assembly | 2.48e-08 |
PRKCA | GO:0051099 | positive regulation of binding | 2.98e-08 |
PRKCA | GO:0071453 | cellular response to oxygen levels | 3.84e-08 |
PRKCA | GO:0062012 | regulation of small molecule metabolic process | 4.19e-08 |
PRKCA | GO:0046879 | hormone secretion | 4.23e-08 |
Top |
Related Drugs to TUFT1_PRKCA |
Drugs used for this fusion-positive patient. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Drug | Source | PMID |
Distribution of the number of studies mentioning TUFT1-PRKCA and kinase inhibitors the PubMed Abstract (04-01-2024) |
Fusion gene - drug pair 1 | Fusion gene - drug pair 2 | PMID | Publication date | DOI | Study title |
Top |
Related Diseases to TUFT1_PRKCA |
Diseases that have this fusion gene. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Disease | Source | PMID |
Related diseases from the literature mentioned this fusion gene and drug. (PubMed, 04-01-2024) |
MeSH ID | MeSH term |
Diseases associated with fusion partners. (DisGeNet 4.0) |
Partner | Gene | Disease ID | Disease name | # pubmeds | Source |
Top |
Clinical Trials of the Found Drugs/Small Molecules |
Statistics of the Clinical Trials of the Found Kinase Inibitors from clinicaltrials.gov (06-17-2024) |
Clinical Trials from clinicaltrials.gov (06-17-2024) |
Fusion Gene | Kinase Inhibitor | NCT ID | Study Status | Phases | Disease | # Enrolment | Date |