| UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
|
|||||||
|
Kinase Fusion Gene:ZFP36_CSK |
Kinase Fusion Protein Summary |
 Kinase Fusion gene summary |
| Kinase Fusion partner gene information | Kinase Fusion gene name: ZFP36_CSK | KinaseFusionDB ID: KFG7251 | FusionGDB2.0 ID: KFG7251 | Hgene | Tgene | Gene symbol | ZFP36 | CSK | Gene ID | 7538 | 1445 | |
| Gene name | ZFP36 ring finger protein | C-terminal Src kinase | ||||||||||
| Synonyms | G0S24|GOS24|NUP475|RNF162A|TIS11|TTP|zfp-36 | - | ||||||||||
| Cytomap | 19q13.2 | 15q24.1 | ||||||||||
| Type of gene | protein-coding | protein-coding | ||||||||||
| Description | mRNA decay activator protein ZFP36G0/G1 switch regulatory protein 24growth factor-inducible nuclear protein NUP475tristetraprolintristetraprolinezinc finger protein 36 homologzinc finger protein 36, C3H type, homolog | tyrosine-protein kinase CSKC-Src kinaseCSK, non-receptor tyrosine kinasec-src tyrosine kinaseprotein-tyrosine kinase CYL | ||||||||||
| Modification date | 20240305 | 20240411 | ||||||||||
| UniProtAcc | P26651 | P41240 | ||||||||||
| Ensembl transtripts involved in fusion gene | ENST ids | ENST00000597629, ENST00000248673, ENST00000594045, | ENST00000220003, ENST00000439220, ENST00000567571, ENST00000309470, | |||||||||
| Context (manual curation of fusion genes in KinaseFusionDB) | PubMed: ZFP36 [Title/Abstract] AND CSK [Title/Abstract] AND fusion [Title/Abstract] | |||||||||||
| Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) | ||||||||||||
| Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Partner | Gene | GO ID | GO term | PubMed ID |
| Hgene | ZFP36 | GO:0000288 | nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay | 23644599 |
| Hgene | ZFP36 | GO:0006402 | mRNA catabolic process | 10751406|11782475 |
| Hgene | ZFP36 | GO:0006402 | mRNA catabolic process | 10330172|20221403 |
| Hgene | ZFP36 | GO:0009611 | response to wounding | 27182009 |
| Hgene | ZFP36 | GO:0031086 | nuclear-transcribed mRNA catabolic process, deadenylation-independent decay | 11279239 |
| Hgene | ZFP36 | GO:0032680 | regulation of tumor necrosis factor production | 15014438 |
| Hgene | ZFP36 | GO:0042594 | response to starvation | 15014438 |
| Hgene | ZFP36 | GO:0043488 | regulation of mRNA stability | 9703499|11719186|15687258|20702587 |
| Hgene | ZFP36 | GO:0044344 | cellular response to fibroblast growth factor stimulus | 20166898 |
| Hgene | ZFP36 | GO:0045647 | negative regulation of erythrocyte differentiation | 20702587 |
| Hgene | ZFP36 | GO:0060213 | positive regulation of nuclear-transcribed mRNA poly(A) tail shortening | 10330172 |
| Hgene | ZFP36 | GO:0061158 | 3'-UTR-mediated mRNA destabilization | 9703499|11719186|15687258|20221403|27193233 |
| Hgene | ZFP36 | GO:0070935 | 3'-UTR-mediated mRNA stabilization | 15014438 |
| Hgene | ZFP36 | GO:0071222 | cellular response to lipopolysaccharide | 14766228 |
| Hgene | ZFP36 | GO:0071356 | cellular response to tumor necrosis factor | 20166898 |
| Hgene | ZFP36 | GO:0071364 | cellular response to epidermal growth factor stimulus | 20166898 |
| Hgene | ZFP36 | GO:0071385 | cellular response to glucocorticoid stimulus | 20166898 |
| Hgene | ZFP36 | GO:0097011 | cellular response to granulocyte macrophage colony-stimulating factor stimulus | 20166898 |
| Hgene | ZFP36 | GO:1900153 | positive regulation of nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay | 12748283 |
| Hgene | ZFP36 | GO:1901835 | positive regulation of deadenylation-independent decapping of nuclear-transcribed mRNA | 16364915 |
| Tgene | CSK | GO:0042997 | negative regulation of Golgi to plasma membrane protein transport | 20605918 |
| Kinase Fusion gene breakpoints across ZFP36 (5'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
| Kinase Fusion gene breakpoints across CSK (3'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Top |
Kinase Fusion Gene Sample Information |
| Kinase Fusion gene information. |
| Kinase Fusion gene information from four resources (ChiTars 5.0, ChimerDB 4.0, COSMIC, and CCLE) * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
| Source | Sample | Hgene | Hchr | Hbp | Tgene | Tchr | Tbp |
| CCLE | U266B1 | ZFP36 | chr19 | 39898616 | CSK | chr15 | 75093038 |
Top |
Kinase Fusion ORF Analysis |
| Kinase Fusion information from ORFfinder translation from full-length transcript sequence from KinaseFusionDB. |
| Henst | Tenst | Hgene | Hchr | Hbp | Tgene | Tchr | Tbp | Seq length (transcript) | Seq length (amino acids) |
| ENST00000248673 | ENST00000220003 | ZFP36 | chr19 | 39898616 | CSK | chr15 | 75093038 | 2976 | 283 |
Top |
Kinase Fusion Amino Acid Sequences |
| For individual full-length fusion transcript sequence from KinaseFusionDB, we ran ORFfinder and chose the longest ORF among the all predicted ones. |
| >Henst_Tenst_Hgene_Hchr_Hbp_Tgene_Tchr_Tbp_length(fusion AA)_AAseq >ENST00000248673_ENST00000220003_ZFP36_chr19_39898616_CSK_chr15_75093038_length(amino acids)=283 MPSTSCHPHPLRPLQPPPPPRATRLSYVGPSQRVGAAATGPSASLPMAWASCARPIATPNTRRNSVTSSTSRAAAPTALAATSSTTLAKT WRPRATLLCFARASASPACPLAAGPHHHHQAWPALPCPPAPSRPPAPHHHLGTFHCHPLPSLLPLAPPWLEETPPQSVAPPAEGPLLSAS GGPWVAWFGPPLYSPWDPTLMNMPAAAAAWGALTLPSSRREFLHHPSPWQPPGDSPSSIASLFLSDKVTARSDQLDLSGEPRLLHCGLCM -------------------------------------------------------------- |
Multiple Sequence Alignment of All Fusion Protein Isoforms |
Top |
Kinase Fusion Protein Functional Features |
| Four levels of functional features of fusion genes Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr19:/chr15:) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
 |
| Main function of each fusion partner protein. (from UniProt) |
| Hgene | Tgene |
| ZFP36 | CSK |
| FUNCTION: Zinc-finger RNA-binding protein that destabilizes several cytoplasmic AU-rich element (ARE)-containing mRNA transcripts by promoting their poly(A) tail removal or deadenylation, and hence provide a mechanism for attenuating protein synthesis (PubMed:9703499, PubMed:10330172, PubMed:10751406, PubMed:11279239, PubMed:12115244, PubMed:12748283, PubMed:15187101, PubMed:15634918, PubMed:17030620, PubMed:16702957, PubMed:20702587, PubMed:20221403, PubMed:21775632, PubMed:27193233, PubMed:23644599, PubMed:25815583, PubMed:31439631). Acts as an 3'-untranslated region (UTR) ARE mRNA-binding adapter protein to communicate signaling events to the mRNA decay machinery (PubMed:15687258, PubMed:23644599). Recruits deadenylase CNOT7 (and probably the CCR4-NOT complex) via association with CNOT1, and hence promotes ARE-mediated mRNA deadenylation (PubMed:23644599). Functions also by recruiting components of the cytoplasmic RNA decay machinery to the bound ARE-containing mRNAs (PubMed:11719186, PubMed:12748283, PubMed:15687258, PubMed:16364915). Self regulates by destabilizing its own mRNA (PubMed:15187101). Binds to 3'-UTR ARE of numerous mRNAs and of its own mRNA (PubMed:10330172, PubMed:10751406, PubMed:12115244, PubMed:15187101, PubMed:15634918, PubMed:17030620, PubMed:16702957, PubMed:19188452, PubMed:20702587, PubMed:20221403, PubMed:21775632, PubMed:25815583). Plays a role in anti-inflammatory responses; suppresses tumor necrosis factor (TNF)-alpha production by stimulating ARE-mediated TNF-alpha mRNA decay and several other inflammatory ARE-containing mRNAs in interferon (IFN)- and/or lipopolysaccharide (LPS)-induced macrophages (By similarity). Also plays a role in the regulation of dendritic cell maturation at the post-transcriptional level, and hence operates as part of a negative feedback loop to limit the inflammatory response (PubMed:18367721). Promotes ARE-mediated mRNA decay of hypoxia-inducible factor HIF1A mRNA during the response of endothelial cells to hypoxia (PubMed:21775632). Positively regulates early adipogenesis of preadipocytes by promoting ARE-mediated mRNA decay of immediate early genes (IEGs) (By similarity). Negatively regulates hematopoietic/erythroid cell differentiation by promoting ARE-mediated mRNA decay of the transcription factor STAT5B mRNA (PubMed:20702587). Plays a role in maintaining skeletal muscle satellite cell quiescence by promoting ARE-mediated mRNA decay of the myogenic determination factor MYOD1 mRNA (By similarity). Associates also with and regulates the expression of non-ARE-containing target mRNAs at the post-transcriptional level, such as MHC class I mRNAs (PubMed:18367721). Participates in association with argonaute RISC catalytic components in the ARE-mediated mRNA decay mechanism; assists microRNA (miRNA) targeting ARE-containing mRNAs (PubMed:15766526). May also play a role in the regulation of cytoplasmic mRNA decapping; enhances decapping of ARE-containing RNAs, in vitro (PubMed:16364915). Involved in the delivery of target ARE-mRNAs to processing bodies (PBs) (PubMed:17369404). In addition to its cytosolic mRNA-decay function, affects nuclear pre-mRNA processing (By similarity). Negatively regulates nuclear poly(A)-binding protein PABPN1-stimulated polyadenylation activity on ARE-containing pre-mRNA during LPS-stimulated macrophages (By similarity). Also involved in the regulation of stress granule (SG) and P-body (PB) formation and fusion (By similarity). Plays a role in the regulation of keratinocyte proliferation, differentiation and apoptosis (PubMed:27182009). Plays a role as a tumor suppressor by inhibiting cell proliferation in breast cancer cells (PubMed:26926077). {ECO:0000250|UniProtKB:P22893, ECO:0000269|PubMed:10330172, ECO:0000269|PubMed:10751406, ECO:0000269|PubMed:11279239, ECO:0000269|PubMed:11719186, ECO:0000269|PubMed:12115244, ECO:0000269|PubMed:12748283, ECO:0000269|PubMed:15187101, ECO:0000269|PubMed:15634918, ECO:0000269|PubMed:15687258, ECO:0000269|PubMed:15766526, ECO:0000269|PubMed:16364915, ECO:0000269|PubMed:16702957, ECO:0000269|PubMed:17030620, ECO:0000269|PubMed:17369404, ECO:0000269|PubMed:18367721, ECO:0000269|PubMed:19188452, ECO:0000269|PubMed:20221403, ECO:0000269|PubMed:20702587, ECO:0000269|PubMed:21775632, ECO:0000269|PubMed:23644599, ECO:0000269|PubMed:25815583, ECO:0000269|PubMed:26926077, ECO:0000269|PubMed:27182009, ECO:0000269|PubMed:27193233, ECO:0000269|PubMed:31439631, ECO:0000269|PubMed:9703499}.; FUNCTION: (Microbial infection) Negatively regulates HTLV-1 TAX-dependent transactivation of viral long terminal repeat (LTR) promoter. {ECO:0000269|PubMed:14679154}. | FUNCTION: Non-receptor tyrosine-protein kinase that plays an important role in the regulation of cell growth, differentiation, migration and immune response. Phosphorylates tyrosine residues located in the C-terminal tails of Src-family kinases (SFKs) including LCK, SRC, HCK, FYN, LYN, CSK or YES1. Upon tail phosphorylation, Src-family members engage in intramolecular interactions between the phosphotyrosine tail and the SH2 domain that result in an inactive conformation. To inhibit SFKs, CSK is recruited to the plasma membrane via binding to transmembrane proteins or adapter proteins located near the plasma membrane. Suppresses signaling by various surface receptors, including T-cell receptor (TCR) and B-cell receptor (BCR) by phosphorylating and maintaining inactive several positive effectors such as FYN or LCK. {ECO:0000269|PubMed:1639064, ECO:0000269|PubMed:9281320}. |
| Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
| - Retained domain in the 5'-partner of fusion protein (protein functional feature from UniProt). |
| Partner | Hgeneene | Hbp | Tgeneene | Tbp | ENST | BPexon | TotalExon | Protein feature loci | BPloci | TotalLen | Feature | Note |
| - Retained domain in the 3'-partner of fusion protein (protein functional feature from UniProt). |
| Partner | Hgeneene | Hbp | Tgeneene | Tbp | ENST | BPexon | TotalExon | Protein feature loci | BPloci | TotalLen | Feature | Note |
| Tgene | ZFP36 | 39898616 | CSK | 75093038 | ENST00000248673 | 0 | 13 | 195_449 | 0 | 451 | Domain | Note=Protein kinase;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00159 |
| Tgene | ZFP36 | 39898616 | CSK | 75093038 | ENST00000248673 | 0 | 14 | 195_449 | 0 | 451 | Domain | Note=Protein kinase;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00159 |
| Tgene | ZFP36 | 39898616 | CSK | 75093038 | ENST00000248673 | 0 | 15 | 195_449 | 0 | 451 | Domain | Note=Protein kinase;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00159 |
| Tgene | ZFP36 | 39898616 | CSK | 75093038 | ENST00000248673 | 0 | 13 | 82_171 | 0 | 451 | Domain | Note=SH2;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00191 |
| Tgene | ZFP36 | 39898616 | CSK | 75093038 | ENST00000248673 | 0 | 14 | 82_171 | 0 | 451 | Domain | Note=SH2;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00191 |
| Tgene | ZFP36 | 39898616 | CSK | 75093038 | ENST00000248673 | 0 | 15 | 82_171 | 0 | 451 | Domain | Note=SH2;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00191 |
Top |
Kinase Fusion Protein Structures |
| CIF files of the predicted kinase fusion proteins * Here we show the 3D structure of the fusion proteins using Mol*. AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Model confidence is shown from the pLDDT values per residue. pLDDT corresponds to the model’s prediction of its score on the local Distance Difference Test. It is a measure of local accuracy (from AlphfaFold website). To color code individual residues, we transformed individual PDB files into CIF format. |
| Kinase Fusion protein CIF link (fusion AA seq ID in KinaseFusionDB) | Henst | Tenst | Hgene | Hchr | Hbp | Tgene | Tchr | Tbp | AA seq | Len(AA seq) |
| PDB file >>>570_ZFP36_CSK | ENST00000248673 | ENST00000220003 | ZFP36 | chr19 | 39898616 | CSK | chr15 | 75093038 | MPSTSCHPHPLRPLQPPPPPRATRLSYVGPSQRVGAAATGPSASLPMAWASCARPIATPNTRRNSVTSSTSRAAAPTALAATSSTTLAKT WRPRATLLCFARASASPACPLAAGPHHHHQAWPALPCPPAPSRPPAPHHHLGTFHCHPLPSLLPLAPPWLEETPPQSVAPPAEGPLLSAS GGPWVAWFGPPLYSPWDPTLMNMPAAAAAWGALTLPSSRREFLHHPSPWQPPGDSPSSIASLFLSDKVTARSDQLDLSGEPRLLHCGLCM | 283 |
| 3D view using mol* of 570_ZFP36_CSK | ||||||||||
| PDB file >>>TKFP_967_ZFP36_CSK | ENST00000248673 | ENST00000220003 | ZFP36 | chr19 | 39898616 | CSK | chr15 | 75093038 | MPSTSCHPHPLRPLQPPPPPRATRLSYVGPSQRVGAAATGPSASLPMAWASCARPIATPNTRRNSVTSSTSRAAAPTALAATSSTTLAKT WRPRATLLCFARASASPACPLAAGPHHHHQAWPALPCPPAPSRPPAPHHHLGTFHCHPLPSLLPLAPPWLEETPPQSVAPPAEGPLLSAS GGPWVAWFGPPLYSPWDPTLMNMPAAAAAWGALTLPSSRREFLHHPSPWQPPGDSPSSIASLFLSDKVTARSDQLDLSGEPRLLHCGLCM | 283_ZFP36_CSK |
Top |
Comparison of Fusion Protein Isoforms |
| Superimpose the 3D Structures Among All Fusion Protein Isoforms * Download the pdb file and open it from the molstar online viewer. |
| Comparison of the Secondary Structures of Fusion Protein Isoforms |
Top |
Comparison of Fusion Protein Sequences/Structures with Known Sequences/Structures from PDB |
Top |
pLDDT score distribution |
| pLDDT score distribution of the predicted fusion protein structures from AlphaFold2 * AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. * The blue color at the bottom marks the best active site residues. |
Top |
Potential Active Site Information |
| The potential binding sites of these fusion proteins were identified using SiteMap, a module of the Schrodinger suite. |
| Kinase Fusion AA seq ID in KinaseFusionDB | Site score | Size | Dscore | Volume | Exposure | Enclosure | Contact | Phobic | Philic | Balance | Don/Acc | Residues |
Top |
Ramachandran Plot of Kinase Fusion Protein Structure |
| Ramachandran plot of the torsional angles - phi (φ)and psi (ψ) - of the residues (amino acids) contained in this fusion protein peptide. |
| 570_ZFP36_CSK_ramachandran.png |
 |
Top |
Virtual Screening Results |
| Distribution of the average docking score across all approved kinase inhibitors. Distribution of the number of occurrence across all approved kinase inhibitors. |
| 5'-kinase fusion protein case |
| 3'-kinase fusion protein case |
Top |
| Drug information from DrugBank of the top 20 interacting small molecules. * The detailed information of individual kinase inhibitors are available in the download page. |
| Fusion gene name info | Drug | Docking score | Glide g score | Glide energy |
Top |
Kinase-Substrate Information of ZFP36_CSK |
| Phosphorylation target of the kinase (phosphosite, 03-17-2024) |
| Kinase | Kinase UniProt Acc | Kinase species | Substrate | Substrate UniProt Acc | Substrate phosphorylated residues | Substrate phosphorylated sites (+/-7AA) | Domain |
| CSK | P41240 | human | EEF2 | P13639 | Y265 | kkLWGDryFDPANGk | GTP_EFTU |
| CSK | P41240 | human | YES1 | P07947 | Y537 | FtAtEPQyQPGENL_ | |
| CSK | P41240 | human | PTPRC | P08575 | Y1218 | MVSTFEQyQFLyDVI | Y_phosphatase |
| CSK | P41240 | human | LCK | P06239 | Y505 | FTAtEGQyQPQP___ | |
| CSK | P41240 | human | SRC | P12931 | Y530 | FTstEPQyQPGENL_ | |
| CSK | P41240 | human | HCK | P08631 | Y411 | RVIEDNEytAREGAk | PK_Tyr_Ser-Thr |
| CSK | P41240 | human | MAPT | P10636-8 | Y29 | DRKDQGGytMHQDQE | |
| CSK | P41240 | human | MAPT | P10636-8 | Y197 | KsGDRsGyssPGsPG | |
| CSK | P41240 | human | EEF2 | P13639 | Y373 | kYRCELLyEGPPDDE | |
| CSK | P41240 | human | SRC | P12931 | Y419 | RLIEDNEytARQGAk | PK_Tyr_Ser-Thr |
| CSK | P41240 | human | FYN | P06241 | Y531 | FtAtEPQyQPGENL_ |
| Biological Network Integration of This Kinase and Substrates (GeneMANIA website) |
| Enriched GO biological processes of the phosphorylation target genes of the kinase |
| Kinase | GOID | GO term | P.adjust |
| CSK | ID | Description | 0.00e+00 |
| CSK | GO:0038094 | Fc-gamma receptor signaling pathway | 4.27e-13 |
| CSK | GO:0038093 | Fc receptor signaling pathway | 6.25e-12 |
| CSK | GO:0002433 | immune response-regulating cell surface receptor signaling pathway involved in phagocytosis | 3.99e-11 |
| CSK | GO:0038096 | Fc-gamma receptor signaling pathway involved in phagocytosis | 3.99e-11 |
| CSK | GO:0002431 | Fc receptor mediated stimulatory signaling pathway | 9.76e-11 |
| CSK | GO:0018108 | peptidyl-tyrosine phosphorylation | 3.27e-08 |
| CSK | GO:0018212 | peptidyl-tyrosine modification | 3.27e-08 |
| CSK | GO:0002862 | negative regulation of inflammatory response to antigenic stimulus | 5.72e-08 |
| CSK | GO:0002429 | immune response-activating cell surface receptor signaling pathway | 5.72e-08 |
| CSK | GO:0002768 | immune response-regulating cell surface receptor signaling pathway | 8.55e-08 |
| CSK | GO:0002861 | regulation of inflammatory response to antigenic stimulus | 1.85e-07 |
| CSK | GO:0031295 | T cell costimulation | 1.85e-07 |
| CSK | GO:0031294 | lymphocyte costimulation | 2.02e-07 |
| CSK | GO:0002757 | immune response-activating signaling pathway | 3.99e-07 |
| CSK | GO:0050728 | negative regulation of inflammatory response | 4.21e-07 |
| CSK | GO:0050777 | negative regulation of immune response | 4.25e-07 |
| CSK | GO:0002764 | immune response-regulating signaling pathway | 4.58e-07 |
| CSK | GO:0006909 | phagocytosis | 7.82e-07 |
| CSK | GO:0002437 | inflammatory response to antigenic stimulus | 9.38e-07 |
| CSK | GO:0050870 | positive regulation of T cell activation | 9.38e-07 |
| CSK | GO:1903039 | positive regulation of leukocyte cell-cell adhesion | 1.41e-06 |
| CSK | GO:0031348 | negative regulation of defense response | 2.83e-06 |
| CSK | GO:0022409 | positive regulation of cell-cell adhesion | 2.83e-06 |
| CSK | GO:0051251 | positive regulation of lymphocyte activation | 3.05e-06 |
| CSK | GO:0036120 | cellular response to platelet-derived growth factor stimulus | 3.05e-06 |
| CSK | GO:0036119 | response to platelet-derived growth factor | 3.81e-06 |
| CSK | GO:0002696 | positive regulation of leukocyte activation | 5.26e-06 |
| CSK | GO:0050863 | regulation of T cell activation | 5.26e-06 |
| CSK | GO:1903037 | regulation of leukocyte cell-cell adhesion | 5.26e-06 |
| CSK | GO:0050867 | positive regulation of cell activation | 5.89e-06 |
| CSK | GO:0050900 | leukocyte migration | 5.89e-06 |
| CSK | GO:0007159 | leukocyte cell-cell adhesion | 7.55e-06 |
| CSK | GO:0050727 | regulation of inflammatory response | 7.86e-06 |
| CSK | GO:0050731 | positive regulation of peptidyl-tyrosine phosphorylation | 1.05e-05 |
| CSK | GO:0032102 | negative regulation of response to external stimulus | 1.35e-05 |
| CSK | GO:0045785 | positive regulation of cell adhesion | 1.35e-05 |
| CSK | GO:0022407 | regulation of cell-cell adhesion | 1.46e-05 |
| CSK | GO:2000116 | regulation of cysteine-type endopeptidase activity | 1.71e-05 |
| CSK | GO:0046777 | protein autophosphorylation | 1.80e-05 |
| CSK | GO:0048013 | ephrin receptor signaling pathway | 2.23e-05 |
| CSK | GO:0050730 | regulation of peptidyl-tyrosine phosphorylation | 3.11e-05 |
| CSK | GO:0052548 | regulation of endopeptidase activity | 7.30e-05 |
| CSK | GO:0052547 | regulation of peptidase activity | 9.80e-05 |
| CSK | GO:0045862 | positive regulation of proteolysis | 1.51e-04 |
| CSK | GO:0071801 | regulation of podosome assembly | 2.35e-04 |
| CSK | GO:2001233 | regulation of apoptotic signaling pathway | 2.40e-04 |
| CSK | GO:2001056 | positive regulation of cysteine-type endopeptidase activity | 3.14e-04 |
| CSK | GO:0050852 | T cell receptor signaling pathway | 4.27e-04 |
| CSK | GO:0071800 | podosome assembly | 4.73e-04 |
Top |
Related Drugs to ZFP36_CSK |
| Drugs used for this fusion-positive patient. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
| Hgene | Tgene | Drug | Source | PMID |
| Distribution of the number of studies mentioning ZFP36-CSK and kinase inhibitors the PubMed Abstract (04-01-2024) |
| Fusion gene - drug pair 1 | Fusion gene - drug pair 2 | PMID | Publication date | DOI | Study title |
Top |
Related Diseases to ZFP36_CSK |
| Diseases that have this fusion gene. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
| Hgene | Tgene | Disease | Source | PMID |
| Related diseases from the literature mentioned this fusion gene and drug. (PubMed, 04-01-2024) |
| MeSH ID | MeSH term |
| Diseases associated with fusion partners. (DisGeNet 4.0) |
| Partner | Gene | Disease ID | Disease name | # pubmeds | Source |
Top |
Clinical Trials of the Found Drugs/Small Molecules |
| Statistics of the Clinical Trials of the Found Kinase Inibitors from clinicaltrials.gov (06-17-2024) |
| Clinical Trials from clinicaltrials.gov (06-17-2024) |
| Fusion Gene | Kinase Inhibitor | NCT ID | Study Status | Phases | Disease | # Enrolment | Date |
Copyright 2024-Present -The University of Texas Health Science Center at Houston
Web File Viewing | Emergency Information |Campus Carry|Site Policies |