UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
|
Kinase Fusion Gene:CAV1_MET |
Kinase Fusion Protein Summary |
Kinase Fusion gene summary |
Kinase Fusion partner gene information | Kinase Fusion gene name: CAV1_MET | KinaseFusionDB ID: KFG940 | FusionGDB2.0 ID: KFG940 | Hgene | Tgene | Gene symbol | CAV1 | MET | Gene ID | 857 | 8731 | |
Gene name | caveolin 1 | RNA guanine-7 methyltransferase | ||||||||||
Synonyms | BSCL3|CGL3|LCCNS|MSTP085|PPH3|VIP21 | CMT1|CMT1c|MET|Met|N7-MTase|RG7MT1|cm1p|hCMT1|hMet | ||||||||||
Cytomap | 7q31.2 | 18p11.21 | ||||||||||
Type of gene | protein-coding | protein-coding | ||||||||||
Description | caveolin-1caveolin 1, caveolae protein, 22kDacell growth-inhibiting protein 32 | mRNA cap guanine-N7 methyltransferaseRNA (guanine-7-) methyltransferasehcm1pmRNA (guanine-7-)methyltransferasemRNA (guanine-N(7)-)-methyltransferasemRNA cap methyltransferase | ||||||||||
Modification date | 20240411 | 20240403 | ||||||||||
UniProtAcc | Q03135 | Q9H1A3 | ||||||||||
Ensembl transtripts involved in fusion gene | ENST ids | ENST00000341049, ENST00000393470, ENST00000405348, ENST00000393468, ENST00000393467, | ENST00000397752, ENST00000318493, ENST00000436117, ENST00000495962, ENST00000539704, | |||||||||
Context (manual curation of fusion genes in KinaseFusionDB) | PubMed: CAV1 [Title/Abstract] AND MET [Title/Abstract] AND fusion [Title/Abstract] | |||||||||||
Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) | MET(116340338)-CAV1(116199000), # samples:3 |
Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
Partner | Gene | GO ID | GO term | PubMed ID |
Hgene | CAV1 | GO:0009617 | response to bacterium | 24625804 |
Hgene | CAV1 | GO:0010875 | positive regulation of cholesterol efflux | 24576892 |
Hgene | CAV1 | GO:0031295 | T cell costimulation | 17287217 |
Hgene | CAV1 | GO:0031623 | receptor internalization | 25893292 |
Hgene | CAV1 | GO:0032570 | response to progesterone | 12388746 |
Hgene | CAV1 | GO:0033137 | negative regulation of peptidyl-serine phosphorylation | 18081315 |
Hgene | CAV1 | GO:0033138 | positive regulation of peptidyl-serine phosphorylation | 18081315 |
Hgene | CAV1 | GO:0043627 | response to estrogen | 12388746 |
Hgene | CAV1 | GO:0051480 | regulation of cytosolic calcium ion concentration | 19052258 |
Hgene | CAV1 | GO:0060070 | canonical Wnt signaling pathway | 16890161 |
Hgene | CAV1 | GO:0072584 | caveolin-mediated endocytosis | 19931615 |
Hgene | CAV1 | GO:1900027 | regulation of ruffle assembly | 24625804 |
Hgene | CAV1 | GO:2000535 | regulation of entry of bacterium into host cell | 24625804 |
Tgene | MET | GO:0006370 | 7-methylguanosine mRNA capping | 27422871 |
Kinase Fusion gene breakpoints across CAV1 (5'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Kinase Fusion gene breakpoints across MET (3'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Top |
Kinase Fusion Gene Sample Information |
Kinase Fusion gene information. |
Kinase Fusion gene information from four resources (ChiTars 5.0, ChimerDB 4.0, COSMIC, and CCLE) * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
Source | Sample | Hgene | Hchr | Hbp | Tgene | Tchr | Tbp |
CCLE | UM-UC-13 | CAV1 | chr7 | 116166743 | MET | chr7 | 116395409 |
Top |
Kinase Fusion ORF Analysis |
Kinase Fusion information from ORFfinder translation from full-length transcript sequence from KinaseFusionDB. |
Henst | Tenst | Hgene | Hchr | Hbp | Tgene | Tchr | Tbp | Seq length (transcript) | Seq length (amino acids) |
ENST00000341049 | ENST00000397752 | CAV1 | chr7 | 116166743 | MET | chr7 | 116395409 | 5207 | 888 |
Top |
Kinase Fusion Amino Acid Sequences |
For individual full-length fusion transcript sequence from KinaseFusionDB, we ran ORFfinder and chose the longest ORF among the all predicted ones. |
>Henst_Tenst_Hgene_Hchr_Hbp_Tgene_Tchr_Tbp_length(fusion AA)_AAseq >ENST00000341049_ENST00000397752_CAV1_chr7_116166743_MET_chr7_116395409_length(amino acids)=888 MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEIDLVNRDPKHLNDDVVKVFPNSAPLEGGTRLTICGWDFGFRR NNKFDLKKTRVLLGNESCTLTLSESTMNTLKCTVGPAMNKHFNMSIIISNGHGTTQYSTFSYVDPVITSISPKYGPMAGGTLLTLTGNYL NSGNSRHISIGGKTCTLKSVSNSILECYTPAQTISTEFAVKLKIDLANRETSIFSYREDPIVYEIHPTKSFISGGSTITGVGKNLNSVSV PRMVINVHEAGRNFTVACQHRSNSEIICCTTPSLQQLNLQLPLKTKAFFMLDGILSKYFDLIYVHNPVFKPFEKPVMISMGNENVLEIKG NDIDPEAVKGEVLKVGNKSCENIHLHSEAVLCTVPNDLLKLNSELNIEWKQAISSTVLGKVIVQPDQNFTGLIAGVVSISTALLLLLGFF LWLKKRKQIKDLGSELVRYDARVHTPHLDRLVSARSVSPTTEMVSNESVDYRATFPEDQFPNSSQNGSCRQVQYPLTDMSPILTSGDSDI SSPLLQNTVHIDLSALNPELVQAVQHVVIGPSSLIVHFNEVIGRGHFGCVYHGTLLDNDGKKIHCAVKSLNRITDIGEVSQFLTEGIIMK DFSHPNVLSLLGICLRSEGSPLVVLPYMKHGDLRNFIRNETHNPTVKDLIGFGLQVAKGMKYLASKKFVHRDLAARNCMLDEKFTVKVAD FGLARDMYDKEYYSVHNKTGAKLPVKWMALESLQTQKFTTKSDVWSFGVLLWELMTRGAPPYPDVNTFDITVYLLQGRRLLQPEYCPDPL -------------------------------------------------------------- |
Multiple Sequence Alignment of All Fusion Protein Isoforms |
Top |
Kinase Fusion Protein Functional Features |
Four levels of functional features of fusion genes Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr7:116340338/chr7:116199000) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
Main function of each fusion partner protein. (from UniProt) |
Hgene | Tgene |
CAV1 | MET |
FUNCTION: May act as a scaffolding protein within caveolar membranes (PubMed:11751885). Forms a stable heterooligomeric complex with CAV2 that targets to lipid rafts and drives caveolae formation. Mediates the recruitment of CAVIN proteins (CAVIN1/2/3/4) to the caveolae (PubMed:19262564). Interacts directly with G-protein alpha subunits and can functionally regulate their activity (By similarity). Involved in the costimulatory signal essential for T-cell receptor (TCR)-mediated T-cell activation. Its binding to DPP4 induces T-cell proliferation and NF-kappa-B activation in a T-cell receptor/CD3-dependent manner (PubMed:17287217). Recruits CTNNB1 to caveolar membranes and may regulate CTNNB1-mediated signaling through the Wnt pathway (By similarity). Negatively regulates TGFB1-mediated activation of SMAD2/3 by mediating the internalization of TGFBR1 from membrane rafts leading to its subsequent degradation (PubMed:25893292). {ECO:0000250|UniProtKB:P49817, ECO:0000269|PubMed:11751885, ECO:0000269|PubMed:17287217, ECO:0000269|PubMed:19262564, ECO:0000269|PubMed:25893292}. | FUNCTION: Protein-histidine N-methyltransferase that specifically catalyzes 1-methylhistidine (pros-methylhistidine) methylation of target proteins (PubMed:33563959, PubMed:34562450). Mediates methylation of proteins with a His-x-His (HxH) motif (where 'x' is preferably a small amino acid) (PubMed:33563959). Catalyzes methylation of target proteins such as S100A9, NDUFB3, SLC39A5, SLC39A7, ARMC6 and DNAJB12; 1-methylhistidine modification may affect the binding of zinc and other metals to its target proteins (PubMed:33563959, PubMed:34562450). Constitutes the main methyltransferase for the 1-methylhistidine modification in cell (PubMed:33563959). {ECO:0000269|PubMed:33563959, ECO:0000269|PubMed:34562450}. |
Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
- Retained domain in the 5'-partner of fusion protein (protein functional feature from UniProt). |
Partner | Hgeneene | Hbp | Tgeneene | Tbp | ENST | BPexon | TotalExon | Protein feature loci | BPloci | TotalLen | Feature | Note |
- Retained domain in the 3'-partner of fusion protein (protein functional feature from UniProt). |
Partner | Hgeneene | Hbp | Tgeneene | Tbp | ENST | BPexon | TotalExon | Protein feature loci | BPloci | TotalLen | Feature | Note |
Tgene | CAV1 | 116166743 | MET | 116395409 | ENST00000341049 | 3 | 9 | 657_739 | 567 | 765 | Domain | Note=IPT/TIG 2 |
Tgene | CAV1 | 116166743 | MET | 116395409 | ENST00000341049 | 4 | 21 | 657_739 | 567 | 1391 | Domain | Note=IPT/TIG 2 |
Tgene | CAV1 | 116166743 | MET | 116395409 | ENST00000341049 | 4 | 21 | 657_739 | 567 | 1409 | Domain | Note=IPT/TIG 2 |
Tgene | CAV1 | 116166743 | MET | 116395409 | ENST00000341049 | 3 | 9 | 742_836 | 567 | 765 | Domain | Note=IPT/TIG 3 |
Tgene | CAV1 | 116166743 | MET | 116395409 | ENST00000341049 | 4 | 21 | 742_836 | 567 | 1391 | Domain | Note=IPT/TIG 3 |
Tgene | CAV1 | 116166743 | MET | 116395409 | ENST00000341049 | 4 | 21 | 742_836 | 567 | 1409 | Domain | Note=IPT/TIG 3 |
Tgene | CAV1 | 116166743 | MET | 116395409 | ENST00000341049 | 3 | 9 | 1078_1345 | 567 | 765 | Domain | Note=Protein kinase;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00159 |
Tgene | CAV1 | 116166743 | MET | 116395409 | ENST00000341049 | 4 | 21 | 1078_1345 | 567 | 1391 | Domain | Note=Protein kinase;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00159 |
Tgene | CAV1 | 116166743 | MET | 116395409 | ENST00000341049 | 4 | 21 | 1078_1345 | 567 | 1409 | Domain | Note=Protein kinase;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00159 |
Top |
Kinase Fusion Protein Structures |
CIF files of the predicted kinase fusion proteins * Here we show the 3D structure of the fusion proteins using Mol*. AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Model confidence is shown from the pLDDT values per residue. pLDDT corresponds to the model’s prediction of its score on the local Distance Difference Test. It is a measure of local accuracy (from AlphfaFold website). To color code individual residues, we transformed individual PDB files into CIF format. |
Kinase Fusion protein CIF link (fusion AA seq ID in KinaseFusionDB) | Henst | Tenst | Hgene | Hchr | Hbp | Tgene | Tchr | Tbp | AA seq | Len(AA seq) |
PDB file >>>83_CAV1_MET | ENST00000341049 | ENST00000397752 | CAV1 | chr7 | 116166743 | MET | chr7 | 116395409 | MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEIDLVNRDPKHLNDDVVKVFPNSAPLEGGTRLTICGWDFGFRR NNKFDLKKTRVLLGNESCTLTLSESTMNTLKCTVGPAMNKHFNMSIIISNGHGTTQYSTFSYVDPVITSISPKYGPMAGGTLLTLTGNYL NSGNSRHISIGGKTCTLKSVSNSILECYTPAQTISTEFAVKLKIDLANRETSIFSYREDPIVYEIHPTKSFISGGSTITGVGKNLNSVSV PRMVINVHEAGRNFTVACQHRSNSEIICCTTPSLQQLNLQLPLKTKAFFMLDGILSKYFDLIYVHNPVFKPFEKPVMISMGNENVLEIKG NDIDPEAVKGEVLKVGNKSCENIHLHSEAVLCTVPNDLLKLNSELNIEWKQAISSTVLGKVIVQPDQNFTGLIAGVVSISTALLLLLGFF LWLKKRKQIKDLGSELVRYDARVHTPHLDRLVSARSVSPTTEMVSNESVDYRATFPEDQFPNSSQNGSCRQVQYPLTDMSPILTSGDSDI SSPLLQNTVHIDLSALNPELVQAVQHVVIGPSSLIVHFNEVIGRGHFGCVYHGTLLDNDGKKIHCAVKSLNRITDIGEVSQFLTEGIIMK DFSHPNVLSLLGICLRSEGSPLVVLPYMKHGDLRNFIRNETHNPTVKDLIGFGLQVAKGMKYLASKKFVHRDLAARNCMLDEKFTVKVAD FGLARDMYDKEYYSVHNKTGAKLPVKWMALESLQTQKFTTKSDVWSFGVLLWELMTRGAPPYPDVNTFDITVYLLQGRRLLQPEYCPDPL | 888 |
3D view using mol* of 83_CAV1_MET | ||||||||||
PDB file >>>TKFP_140_CAV1_MET | ENST00000341049 | ENST00000397752 | CAV1 | chr7 | 116166743 | MET | chr7 | 116395409 | MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEIDLVNRDPKHLNDDVVKVFPNSAPLEGGTRLTICGWDFGFRR NNKFDLKKTRVLLGNESCTLTLSESTMNTLKCTVGPAMNKHFNMSIIISNGHGTTQYSTFSYVDPVITSISPKYGPMAGGTLLTLTGNYL NSGNSRHISIGGKTCTLKSVSNSILECYTPAQTISTEFAVKLKIDLANRETSIFSYREDPIVYEIHPTKSFISGGSTITGVGKNLNSVSV PRMVINVHEAGRNFTVACQHRSNSEIICCTTPSLQQLNLQLPLKTKAFFMLDGILSKYFDLIYVHNPVFKPFEKPVMISMGNENVLEIKG NDIDPEAVKGEVLKVGNKSCENIHLHSEAVLCTVPNDLLKLNSELNIEWKQAISSTVLGKVIVQPDQNFTGLIAGVVSISTALLLLLGFF LWLKKRKQIKDLGSELVRYDARVHTPHLDRLVSARSVSPTTEMVSNESVDYRATFPEDQFPNSSQNGSCRQVQYPLTDMSPILTSGDSDI SSPLLQNTVHIDLSALNPELVQAVQHVVIGPSSLIVHFNEVIGRGHFGCVYHGTLLDNDGKKIHCAVKSLNRITDIGEVSQFLTEGIIMK DFSHPNVLSLLGICLRSEGSPLVVLPYMKHGDLRNFIRNETHNPTVKDLIGFGLQVAKGMKYLASKKFVHRDLAARNCMLDEKFTVKVAD FGLARDMYDKEYYSVHNKTGAKLPVKWMALESLQTQKFTTKSDVWSFGVLLWELMTRGAPPYPDVNTFDITVYLLQGRRLLQPEYCPDPL | 888_CAV1_MET |
Top |
Comparison of Fusion Protein Isoforms |
Superimpose the 3D Structures Among All Fusion Protein Isoforms * Download the pdb file and open it from the molstar online viewer. |
3D view using mol* of viewer/superimpose_isoforms/HKFP_244_MET_CAV1_vs_HKFP_245_MET_CAV1_superimposed.pdb.html |
Comparison of the Secondary Structures of Fusion Protein Isoforms |
Top |
Comparison of Fusion Protein Sequences/Structures with Known Sequences/Structures from PDB |
Top |
pLDDT score distribution |
pLDDT score distribution of the predicted fusion protein structures from AlphaFold2 * AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. * The blue color at the bottom marks the best active site residues. |
83_CAV1_MET.png |
83_CAV1_MET.png |
Top |
Potential Active Site Information |
The potential binding sites of these fusion proteins were identified using SiteMap, a module of the Schrodinger suite. |
Kinase Fusion AA seq ID in KinaseFusionDB | Site score | Size | Dscore | Volume | Exposure | Enclosure | Contact | Phobic | Philic | Balance | Don/Acc | Residues |
Top |
Ramachandran Plot of Kinase Fusion Protein Structure |
Ramachandran plot of the torsional angles - phi (φ)and psi (ψ) - of the residues (amino acids) contained in this fusion protein peptide. |
83_CAV1_MET_ramachandran.png |
Top |
Virtual Screening Results |
Distribution of the average docking score across all approved kinase inhibitors. Distribution of the number of occurrence across all approved kinase inhibitors. |
5'-kinase fusion protein case |
3'-kinase fusion protein case |
Top |
Drug information from DrugBank of the top 20 interacting small molecules. * The detailed information of individual kinase inhibitors are available in the download page. |
Fusion gene name info | Drug | Docking score | Glide g score | Glide energy |
83_CAV1_MET-DOCK_HTVS_1-001 | Lapatinib | -8.82498 | -8.913780000000001 | -69.5851 |
83_CAV1_MET-DOCK_HTVS_1-001 | Lapatinib | -8.68261 | -8.771410000000001 | -66.1516 |
83_CAV1_MET-DOCK_HTVS_1-001 | Dacomitinib | -7.7682899999999995 | -7.876589999999999 | -56.2737 |
83_CAV1_MET-DOCK_HTVS_1-001 | Dacomitinib | -7.7682899999999995 | -7.876589999999999 | -56.2737 |
83_CAV1_MET-DOCK_HTVS_1-001 | Acalabrutinib | -7.75736 | -7.77146 | -38.9864 |
83_CAV1_MET-DOCK_HTVS_1-001 | Acalabrutinib | -7.75736 | -7.77146 | -38.9864 |
83_CAV1_MET-DOCK_HTVS_1-001 | Dacomitinib | -7.73537 | -7.84437 | -55.8637 |
83_CAV1_MET-DOCK_HTVS_1-001 | Nilotinib | -7.65897 | -7.79857 | -50.5098 |
83_CAV1_MET-DOCK_HTVS_1-001 | Nilotinib | -7.65897 | -7.79857 | -50.5098 |
83_CAV1_MET-DOCK_HTVS_1-001 | Lapatinib | -7.48085 | -8.64925 | -58.9421 |
83_CAV1_MET-DOCK_HTVS_1-001 | Lapatinib | -7.48085 | -8.64925 | -58.9421 |
83_CAV1_MET-DOCK_HTVS_1-001 | Sorafenib | -7.148289999999999 | -7.16039 | -59.4221 |
83_CAV1_MET-DOCK_HTVS_1-001 | Sorafenib | -7.148289999999999 | -7.16039 | -59.4221 |
83_CAV1_MET-DOCK_HTVS_1-001 | Futibatinib | -7.01853 | -7.01853 | -50.7491 |
83_CAV1_MET-DOCK_HTVS_1-001 | Binimetinib | -6.965210000000001 | -6.973910000000001 | -35.3012 |
83_CAV1_MET-DOCK_HTVS_1-001 | Binimetinib | -6.965210000000001 | -6.973910000000001 | -35.3012 |
83_CAV1_MET-DOCK_HTVS_1-001 | Ripretinib | -6.95565 | -6.96265 | -52.0865 |
83_CAV1_MET-DOCK_HTVS_1-001 | Ripretinib | -6.95565 | -6.96265 | -52.0865 |
83_CAV1_MET-DOCK_HTVS_1-001 | Futibatinib | -6.8633 | -6.8633 | -46.0313 |
83_CAV1_MET-DOCK_HTVS_1-001 | Upadacitinib | -6.70223 | -6.7032300000000005 | -32.0254 |
Top |
Kinase-Substrate Information of CAV1_MET |
Phosphorylation target of the kinase (phosphosite, 03-17-2024) |
Kinase | Kinase UniProt Acc | Kinase species | Substrate | Substrate UniProt Acc | Substrate phosphorylated residues | Substrate phosphorylated sites (+/-7AA) | Domain |
MET | P08581 | human | MST1R | Q04912 | Y1353 | SALLGDHyVQLPATy | |
MET | P08581 | human | FIS1 | Q9Y3D6 | Y38 | sKSTQFEyAWCLVRS | Fis1_TPR_N |
MET | P08581 | human | IRS1 | P35568 | Y612 | tLHtDDGyMPMsPGV | |
MET | P08581 | human | PTK2 | Q05397 | Y925 | DRsNDkVyENVtGLV | Focal_AT |
MET | P08581 | human | MET | P08581 | Y1349 | stFIGEHyVHVNAty | |
MET | P08581 | human | MET | P08581 | Y1365 | NVKCVAPyPsLLssE | |
MET | P08581 | human | IRS1 | P35568 | Y896 | EPKsPGEyVNIEFGS | |
MET | P08581 | human | PTK2 | Q05397 | Y577 | yMEDstyyKAsKGKL | PK_Tyr_Ser-Thr |
MET | P08581 | human | RHOA | P61586 | Y42 | VPTVFENyVADIEVD | Ras |
MET | P08581 | human | MST1R | Q04912 | Y1360 | yVQLPATyMNLGPST | |
MET | P08581 | human | MST1R | Q04912 | Y1238 | RDILDREyysVQQHR | PK_Tyr_Ser-Thr |
MET | P08581 | human | IQGAP1 | P46940 | Y1510 | LVkLQQtyAALNskA | RasGAP_C |
MET | P08581 | human | PTK2 | Q05397 | Y407 | IIDEEDtytMPSTRD | |
MET | P08581 | human | MET | P08581 | Y1230 | FGLARDMyDkEyysV | PK_Tyr_Ser-Thr |
MET | P08581 | human | PARP1 | P09874 | Y907 | MVSKSANyCHTSQGD | PARP |
MET | P08581 | human | SHC1 | P29353 | Y427 | ELFDDPsyVNVQNLD | |
MET | P08581 | human | MET | P08581 | Y1356 | yVHVNAtyVNVKCVA | |
MET | P08581 | human | PTK2 | Q05397 | Y5 | ___MAAAyLDPNLNH | |
MET | P08581 | human | PTK2 | Q05397 | Y397 | sVsEtDDyAEIIDEE | |
MET | P08581 | human | PTK2 | Q05397 | Y861 | PIGNQHIyQPVGKPD | |
MET | P08581 | human | PBK | Q96KB5 | Y74 | NPICNDHyRsVyQkR | Pkinase |
MET | P08581 | human | PTK2 | Q05397 | Y194 | ALEKKSNyEVLEkDV | FERM_M |
MET | P08581 | human | MET | P08581 | Y1234 | RDMyDkEyysVHNkt | PK_Tyr_Ser-Thr |
MET | P08581 | human | PTK2 | Q05397 | Y576 | RyMEDstyyKAsKGK | PK_Tyr_Ser-Thr |
MET | P08581 | human | INSR | P06213 | Y1185 | FGMTRDIyEtDyyRk | PK_Tyr_Ser-Thr |
MET | P08581 | human | MET | P08581 | Y1235 | DMyDkEyysVHNktG | PK_Tyr_Ser-Thr |
MET | P08581 | human | GSK3B | P49841 | Y56 | DRPQEVSyTDTKVIG | Pkinase |
MET | P08581 | human | MST1R | Q04912 | Y1239 | DILDREyysVQQHRH | PK_Tyr_Ser-Thr |
Biological Network Integration of This Kinase and Substrates (GeneMANIA website) |
Enriched GO biological processes of the phosphorylation target genes of the kinase |
Kinase | GOID | GO term | P.adjust |
MET | ID | Description | 0.00e+00 |
MET | GO:0033674 | positive regulation of kinase activity | 4.44e-07 |
MET | GO:0051347 | positive regulation of transferase activity | 9.31e-07 |
MET | GO:0071375 | cellular response to peptide hormone stimulus | 5.90e-06 |
MET | GO:1901653 | cellular response to peptide | 1.35e-05 |
MET | GO:0032869 | cellular response to insulin stimulus | 2.06e-05 |
MET | GO:0043434 | response to peptide hormone | 2.06e-05 |
MET | GO:0032868 | response to insulin | 6.57e-05 |
MET | GO:0045860 | positive regulation of protein kinase activity | 7.26e-05 |
MET | GO:0008286 | insulin receptor signaling pathway | 8.83e-05 |
MET | GO:0005979 | regulation of glycogen biosynthetic process | 8.83e-05 |
MET | GO:0010962 | regulation of glucan biosynthetic process | 8.83e-05 |
MET | GO:0043467 | regulation of generation of precursor metabolites and energy | 1.23e-04 |
MET | GO:0070873 | regulation of glycogen metabolic process | 1.40e-04 |
MET | GO:0032885 | regulation of polysaccharide biosynthetic process | 1.41e-04 |
MET | GO:0045936 | negative regulation of phosphate metabolic process | 1.52e-04 |
MET | GO:0010563 | negative regulation of phosphorus metabolic process | 1.52e-04 |
MET | GO:0005978 | glycogen biosynthetic process | 1.72e-04 |
MET | GO:0009250 | glucan biosynthetic process | 1.72e-04 |
MET | GO:0032881 | regulation of polysaccharide metabolic process | 1.72e-04 |
MET | GO:0016051 | carbohydrate biosynthetic process | 4.12e-04 |
MET | GO:0000271 | polysaccharide biosynthetic process | 4.65e-04 |
MET | GO:0005977 | glycogen metabolic process | 6.80e-04 |
MET | GO:0044042 | glucan metabolic process | 7.00e-04 |
MET | GO:0031016 | pancreas development | 7.00e-04 |
MET | GO:1900543 | negative regulation of purine nucleotide metabolic process | 7.39e-04 |
MET | GO:0045980 | negative regulation of nucleotide metabolic process | 8.69e-04 |
MET | GO:0006112 | energy reserve metabolic process | 8.90e-04 |
MET | GO:0043491 | phosphatidylinositol 3-kinase/protein kinase B signal transduction | 9.74e-04 |
MET | GO:0005976 | polysaccharide metabolic process | 1.25e-03 |
MET | GO:0043255 | regulation of carbohydrate biosynthetic process | 1.32e-03 |
MET | GO:0007173 | epidermal growth factor receptor signaling pathway | 1.35e-03 |
MET | GO:0045725 | positive regulation of glycogen biosynthetic process | 1.35e-03 |
MET | GO:0015980 | energy derivation by oxidation of organic compounds | 1.44e-03 |
MET | GO:0062012 | regulation of small molecule metabolic process | 1.44e-03 |
MET | GO:0070875 | positive regulation of glycogen metabolic process | 1.59e-03 |
MET | GO:0038127 | ERBB signaling pathway | 1.79e-03 |
MET | GO:0001952 | regulation of cell-matrix adhesion | 1.79e-03 |
MET | GO:0071902 | positive regulation of protein serine/threonine kinase activity | 2.45e-03 |
MET | GO:1903578 | regulation of ATP metabolic process | 2.89e-03 |
MET | GO:0030010 | establishment of cell polarity | 3.21e-03 |
MET | GO:0070507 | regulation of microtubule cytoskeleton organization | 3.41e-03 |
MET | GO:1902410 | mitotic cytokinetic process | 3.41e-03 |
MET | GO:0051897 | positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction | 3.91e-03 |
MET | GO:0043410 | positive regulation of MAPK cascade | 4.19e-03 |
MET | GO:2000058 | regulation of ubiquitin-dependent protein catabolic process | 4.21e-03 |
MET | GO:0001667 | ameboidal-type cell migration | 4.74e-03 |
MET | GO:0006109 | regulation of carbohydrate metabolic process | 4.74e-03 |
MET | GO:0035305 | negative regulation of dephosphorylation | 5.05e-03 |
MET | GO:0031334 | positive regulation of protein-containing complex assembly | 5.26e-03 |
Top |
Related Drugs to CAV1_MET |
Drugs used for this fusion-positive patient. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Drug | Source | PMID |
Distribution of the number of studies mentioning CAV1-MET and kinase inhibitors the PubMed Abstract (04-01-2024) |
Fusion gene - drug pair 1 | Fusion gene - drug pair 2 | PMID | Publication date | DOI | Study title |
CAV1-MET AND Crizotinib | CAV1-MET AND Osimertinib | 31122565 | 2019-6 | 10.1016/j.jtho.2019.01.025 | A Novel CAV1-MET Fusion in SCLC Transformation Responds to Crizotinib and Osimertinib Treatment. |
Top |
Related Diseases to CAV1_MET |
Diseases that have this fusion gene. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Disease | Source | PMID |
Related diseases from the literature mentioned this fusion gene and drug. (PubMed, 04-01-2024) |
MeSH ID | MeSH term |
Diseases associated with fusion partners. (DisGeNet 4.0) |
Partner | Gene | Disease ID | Disease name | # pubmeds | Source |
Top |
Clinical Trials of the Found Drugs/Small Molecules |
Statistics of the Clinical Trials of the Found Kinase Inibitors from clinicaltrials.gov (06-17-2024) |
Clinical Trials from clinicaltrials.gov (06-17-2024) |
Fusion Gene | Kinase Inhibitor | NCT ID | Study Status | Phases | Disease | # Enrolment | Date |