UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY

Home

Download

Statistics

Examples

Help

Contact

	Kinase Fusion Gene Summary
	Kinase Fusion Gene Sample Information
	Kinase Fusion ORF Analysis
	Kinase Fusion Amino Acid Sequences
	Multiple Sequence Alignment of All Fusion Protein Isoforms
	Kinase Fusion Protein Functional Features
	Kinase Fusion Protein Structures
	Comparison of Fusion Protein Isoforms
	Comparison of Fusion Protein Sequences/Structures with Known Sequences/Structures from PDB
	pLDDT Scores and Difference Analysis of pLDDT Scores Between the Active Sites (Best) and Non-Active Sites.
	Ramachandran Plot of Kinase Fusion Protein Structure
	Potential Active Site Information
	Virtual Screening Results
	Kinase-Substrate Information
	Related Drugs with This Kinase Fusion Protein
	Related Disease with This Kinase Fusion Protein
	Clinical Trials of the Found Drugs/Small Molecules

Kinase Fusion Gene:CD74_NTRK1

Kinase Fusion Protein Summary

Kinase Fusion gene summary

Kinase Fusion partner gene information	Kinase Fusion gene name: CD74_NTRK1
	KinaseFusionDB ID: KFG990
	FusionGDB2.0 ID: KFG990
		Hgene	Tgene
	Gene symbol	CD74	NTRK1
	Gene ID	972	4914
	Gene name	CD74 molecule	neurotrophic receptor tyrosine kinase 1
	Synonyms	CLIP\|DHLAG\|HLADG\|II\|Ia-GAMMA\|p33	MTC\|TRK\|TRK1\|TRKA\|Trk-A\|p140-TrkA
	Cytomap	5q33.1	1q23.1
	Type of gene	protein-coding	protein-coding
	Description	HLA class II histocompatibility antigen gamma chainCD74 antigen (invariant polypeptide of major histocompatibility complex, class II antigen-associated)CD74 molecule, major histocompatibility complex, class II invariant chainHLA-DR antigens-associated	high affinity nerve growth factor receptorOncogene TRKTRK1-transforming tyrosine kinase proteingp140trkneurotrophic tyrosine kinase, receptor, type 1tropomyosin receptor kinase Atropomyosin-related kinase Atyrosine kinase receptor A
	Modification date	20240317	20240411
	UniProtAcc	P04233	P04629
Ensembl transtripts involved in fusion gene	ENST ids	ENST00000377795, ENST00000009530, ENST00000353334, ENST00000524315,	ENST00000358660, ENST00000368196, ENST00000392302, ENST00000524377, ENST00000531606,
Context (manual curation of fusion genes in KinaseFusionDB)	PubMed: CD74 [Title/Abstract] AND NTRK1 [Title/Abstract] AND fusion [Title/Abstract]
Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0)	CD74(149782126)-NTRK1(156844360), # samples:2

Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez

Partner	Gene	GO ID	GO term	PubMed ID
Hgene	CD74	GO:0001516	prostaglandin biosynthetic process	12782713
Hgene	CD74	GO:0001934	positive regulation of protein phosphorylation	24942581
Hgene	CD74	GO:0002792	negative regulation of peptide secretion	19849849
Hgene	CD74	GO:0033674	positive regulation of kinase activity	24942581
Hgene	CD74	GO:0034341	response to type II interferon	32855215
Hgene	CD74	GO:0043066	negative regulation of apoptotic process	12782713
Hgene	CD74	GO:0043123	positive regulation of canonical NF-kappaB signal transduction	24942581
Hgene	CD74	GO:0043410	positive regulation of MAPK cascade	24942581
Hgene	CD74	GO:0043518	negative regulation of DNA damage response, signal transduction by p53 class mediator	17045821
Hgene	CD74	GO:0045657	positive regulation of monocyte differentiation	24942581
Hgene	CD74	GO:0045893	positive regulation of DNA-templated transcription	24942581
Hgene	CD74	GO:0046598	positive regulation of viral entry into host cell	24942581
Hgene	CD74	GO:0050731	positive regulation of peptidyl-tyrosine phosphorylation	17045821
Hgene	CD74	GO:0070374	positive regulation of ERK1 and ERK2 cascade	17045821\|24942581
Tgene	NTRK1	GO:0006468	protein phosphorylation	15488758
Tgene	NTRK1	GO:0008285	negative regulation of cell population proliferation	15488758
Tgene	NTRK1	GO:0010976	positive regulation of neuron projection development	15488758
Tgene	NTRK1	GO:0018108	peptidyl-tyrosine phosphorylation	2927393
Tgene	NTRK1	GO:0043547	positive regulation of GTPase activity	15488758
Tgene	NTRK1	GO:0046579	positive regulation of Ras protein signal transduction	15488758
Tgene	NTRK1	GO:0046777	protein autophosphorylation	15488758
Tgene	NTRK1	GO:0048011	neurotrophin TRK receptor signaling pathway	15488758
Tgene	NTRK1	GO:0051092	positive regulation of NF-kappaB transcription factor activity	15488758
Tgene	NTRK1	GO:0070374	positive regulation of ERK1 and ERK2 cascade	15488758
Tgene	NTRK1	GO:1904646	cellular response to amyloid-beta	11927634

Kinase Fusion gene breakpoints across CD74 (5'-gene)
* Click on the image to open the UCSC genome browser with custom track showing this image in a new window.

Kinase Fusion gene breakpoints across NTRK1 (3'-gene)
* Click on the image to open the UCSC genome browser with custom track showing this image in a new window.

Top

Kinase Fusion Gene Sample Information

Kinase Fusion gene information.

Kinase Fusion gene information from four resources (ChiTars 5.0, ChimerDB 4.0, COSMIC, and CCLE)
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.

Source	Sample	Hgene	Hchr	Hbp	Tgene	Tchr	Tbp
ChiTaRS5.0	HG532018	CD74	chr5	149782126	NTRK1	chr1	156844360
ChimerDB4	HG532018	CD74	chr5	149792499	NTRK1	chr1	156844360

Top

Kinase Fusion ORF Analysis

Kinase Fusion information from ORFfinder translation from full-length transcript sequence from KinaseFusionDB.

Henst	Tenst	Hgene	Hchr	Hbp	Tgene	Tchr	Tbp	Seq length (transcript)	Seq length (amino acids)
ENST00000353334	ENST00000392302	CD74	chr5	149782126	NTRK1	chr1	156844360	2216	627

Top

Kinase Fusion Amino Acid Sequences

For individual full-length fusion transcript sequence from KinaseFusionDB, we ran ORFfinder and chose the longest ORF among the all predicted ones.

>Henst_Tenst_Hgene_Hchr_Hbp_Tgene_Tchr_Tbp_length(fusion AA)_AAseq

>ENST00000353334_ENST00000392302_CD74_chr5_149782126_NTRK1_chr1_156844360_length(amino acids)=627
MHRRRSRSCREDQKPVMDDQRDLISNNEQLPMLGRRPGAPESKCSRGALYTGFSILVTLLLAGQATTAYFLYQQQGRLDKLTVTSQNLQL
ENLRMKLPKPPKPVSKMRMATPLLMQALPMGALPQGPMQNATKYGNMTEDHVMHLLQNADPLKVYPPLKGSFPENLRHLKNTMETIDWKV
FESWMHHWLLFEMSRHSLEQKPTDAPPKESLELEDPSSGLGVTKQDLGPDTNSTSGDPVEKKDETPFGVSVAVGLAVFACLFLSTLLLVL
NKCGRRNKFGINRPAVLAPEDGLAMSLHFMTLGGSSLSPTEGKGSGLQGHIIENPQYFSDACVHHIKRRDIVLKWELGEGAFGKVFLAEC
HNLLPEQDKMLVAVKALKEASESARQDFQREAELLTMLQHQHIVRFFGVCTEGRPLLMVFEYMRHGDLNRFLRSHGPDAKLLAGGEDVAP
GPLGLGQLLAVASQVAAGMVYLAGLHFVHRDLATRNCLVGQGLVVKIGDFGMSRDIYSTDYYRVGGRTMLPIRWMPPESILYRKFTTESD

--------------------------------------------------------------

Multiple Sequence Alignment of All Fusion Protein Isoforms

Top

Kinase Fusion Protein Functional Features

Four levels of functional features of fusion genes
Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr5:149782126/chr1:156844360)
- FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels.
- How to search
1. Put your fusion gene symbol.
2. Press the tab key until there will be shown the breakpoint information filled.
4. Go down and press 'Search' tab twice.
4. Go down to have the hyperlink of the search result.
5. Click the hyperlink.
6. See the FGviewer result for your fusion gene.

Main function of each fusion partner protein. (from UniProt)

Hgene	Tgene
CD74 P04233	NTRK1 P04629
FUNCTION: Plays a critical role in MHC class II antigen processing by stabilizing peptide-free class II alpha/beta heterodimers in a complex soon after their synthesis and directing transport of the complex from the endoplasmic reticulum to the endosomal/lysosomal system where the antigen processing and binding of antigenic peptides to MHC class II takes place. Serves as cell surface receptor for the cytokine MIF.; FUNCTION: [Class-II-associated invariant chain peptide]: Binds to the peptide-binding site of MHC class II alpha/beta heterodimers forming an alpha-beta-CLIP complex, thereby preventing the loading of antigenic peptides to the MHC class II complex until its release by HLA-DM in the endosome. {ECO:0000269\|PubMed:1448172}.; FUNCTION: [Isoform p41]: Stabilizes the conformation of mature CTSL by binding to its active site and serving as a chaperone to help maintain a pool of mature enzyme in endocytic compartments and extracellular space of antigen-presenting cells (APCs). Has antiviral activity by stymieing the endosomal entry of Ebola virus and coronaviruses, including SARS-CoV-2 (PubMed:32855215). Disrupts cathepsin-mediated Ebola virus glycoprotein processing, which prevents viral fusion and entry. This antiviral activity is specific to p41 isoform (PubMed:32855215). {ECO:0000250\|UniProtKB:P04441, ECO:0000269\|PubMed:32855215}.	FUNCTION: Receptor tyrosine kinase involved in the development and the maturation of the central and peripheral nervous systems through regulation of proliferation, differentiation and survival of sympathetic and nervous neurons. High affinity receptor for NGF which is its primary ligand (PubMed:1850821, PubMed:1849459, PubMed:1281417, PubMed:8325889, PubMed:15488758, PubMed:22649032, PubMed:17196528, PubMed:27445338). Can also bind and be activated by NTF3/neurotrophin-3. However, NTF3 only supports axonal extension through NTRK1 but has no effect on neuron survival (By similarity). Upon dimeric NGF ligand-binding, undergoes homodimerization, autophosphorylation and activation (PubMed:1281417). Recruits, phosphorylates and/or activates several downstream effectors including SHC1, FRS2, SH2B1, SH2B2 and PLCG1 that regulate distinct overlapping signaling cascades driving cell survival and differentiation. Through SHC1 and FRS2 activates a GRB2-Ras-MAPK cascade that regulates cell differentiation and survival. Through PLCG1 controls NF-Kappa-B activation and the transcription of genes involved in cell survival. Through SHC1 and SH2B1 controls a Ras-PI3 kinase-AKT1 signaling cascade that is also regulating survival. In absence of ligand and activation, may promote cell death, making the survival of neurons dependent on trophic factors. {ECO:0000250\|UniProtKB:P35739, ECO:0000250\|UniProtKB:Q3UFB7, ECO:0000269\|PubMed:11244088, ECO:0000269\|PubMed:1281417, ECO:0000269\|PubMed:15488758, ECO:0000269\|PubMed:17196528, ECO:0000269\|PubMed:1849459, ECO:0000269\|PubMed:1850821, ECO:0000269\|PubMed:22649032, ECO:0000269\|PubMed:27445338, ECO:0000269\|PubMed:27676246, ECO:0000269\|PubMed:8155326, ECO:0000269\|PubMed:8325889}.; FUNCTION: [Isoform TrkA-III]: Resistant to NGF, it constitutively activates AKT1 and NF-kappa-B and is unable to activate the Ras-MAPK signaling cascade. Antagonizes the anti-proliferative NGF-NTRK1 signaling that promotes neuronal precursors differentiation. Isoform TrkA-III promotes angiogenesis and has oncogenic activity when overexpressed. {ECO:0000269\|PubMed:15488758}.

Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at
download page
* Minus value of BPloci means that the break pointn is located before the CDS.

- Retained domain in the 5'-partner of fusion protein (protein functional feature from UniProt).

Partner

Hgeneene

Hbp

Tgeneene

Tbp

ENST

BPexon

TotalExon

Protein feature loci

BPloci

TotalLen

Feature

Note

- Retained domain in the 3'-partner of fusion protein (protein functional feature from UniProt).

Partner

Hgeneene

Hbp

Tgeneene

Tbp

ENST

BPexon

TotalExon

Protein feature loci

BPloci

TotalLen

Feature

Note

Tgene

CD74

149782126

NTRK1

156844360

ENST00000353334

510_781

392

791

Domain

Note=Protein kinase;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00159

Tgene

CD74

149782126

NTRK1

156844360

ENST00000353334

510_781

362

761

Domain

Note=Protein kinase;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00159

Tgene

CD74

149782126

NTRK1

156844360

ENST00000353334

510_781

398

797

Domain

Note=Protein kinase;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00159

Top

Kinase Fusion Protein Structures

CIF files of the predicted kinase fusion proteins
* Here we show the 3D structure of the fusion proteins using Mol*. AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Model confidence is shown from the pLDDT values per residue. pLDDT corresponds to the model’s prediction of its score on the local Distance Difference Test. It is a measure of local accuracy (from AlphfaFold website). To color code individual residues, we transformed individual PDB files into CIF format.

Kinase Fusion protein CIF link (fusion AA seq ID in KinaseFusionDB)	Henst	Tenst	Hgene	Hchr	Hbp	Tgene	Tchr	Tbp	AA seq	Len(AA seq)
PDB file >>>90_CD74_NTRK1	ENST00000353334	ENST00000392302	CD74	chr5	149782126	NTRK1	chr1	156844360	MHRRRSRSCREDQKPVMDDQRDLISNNEQLPMLGRRPGAPESKCSRGALYTGFSILVTLLLAGQATTAYFLYQQQGRLDKLTVTSQNLQL ENLRMKLPKPPKPVSKMRMATPLLMQALPMGALPQGPMQNATKYGNMTEDHVMHLLQNADPLKVYPPLKGSFPENLRHLKNTMETIDWKV FESWMHHWLLFEMSRHSLEQKPTDAPPKESLELEDPSSGLGVTKQDLGPDTNSTSGDPVEKKDETPFGVSVAVGLAVFACLFLSTLLLVL NKCGRRNKFGINRPAVLAPEDGLAMSLHFMTLGGSSLSPTEGKGSGLQGHIIENPQYFSDACVHHIKRRDIVLKWELGEGAFGKVFLAEC HNLLPEQDKMLVAVKALKEASESARQDFQREAELLTMLQHQHIVRFFGVCTEGRPLLMVFEYMRHGDLNRFLRSHGPDAKLLAGGEDVAP GPLGLGQLLAVASQVAAGMVYLAGLHFVHRDLATRNCLVGQGLVVKIGDFGMSRDIYSTDYYRVGGRTMLPIRWMPPESILYRKFTTESD	627
3D view using mol* of 90_CD74_NTRK1

PDB file >>>TKFP_153_CD74_NTRK1	ENST00000353334	ENST00000392302	CD74	chr5	149782126	NTRK1	chr1	156844360	MHRRRSRSCREDQKPVMDDQRDLISNNEQLPMLGRRPGAPESKCSRGALYTGFSILVTLLLAGQATTAYFLYQQQGRLDKLTVTSQNLQL ENLRMKLPKPPKPVSKMRMATPLLMQALPMGALPQGPMQNATKYGNMTEDHVMHLLQNADPLKVYPPLKGSFPENLRHLKNTMETIDWKV FESWMHHWLLFEMSRHSLEQKPTDAPPKESLELEDPSSGLGVTKQDLGPDTNSTSGDPVEKKDETPFGVSVAVGLAVFACLFLSTLLLVL NKCGRRNKFGINRPAVLAPEDGLAMSLHFMTLGGSSLSPTEGKGSGLQGHIIENPQYFSDACVHHIKRRDIVLKWELGEGAFGKVFLAEC HNLLPEQDKMLVAVKALKEASESARQDFQREAELLTMLQHQHIVRFFGVCTEGRPLLMVFEYMRHGDLNRFLRSHGPDAKLLAGGEDVAP GPLGLGQLLAVASQVAAGMVYLAGLHFVHRDLATRNCLVGQGLVVKIGDFGMSRDIYSTDYYRVGGRTMLPIRWMPPESILYRKFTTESD	627_CD74_NTRK1

Top

Comparison of Fusion Protein Isoforms

Superimpose the 3D Structures Among All Fusion Protein Isoforms
* Download the pdb file and open it from the molstar online viewer.

Comparison of the Secondary Structures of Fusion Protein Isoforms

Top

Comparison of Fusion Protein Sequences/Structures with Known Sequences/Structures from PDB

Abstract of the Multiple Sequence Alignment of the Longest Fusion Protein Sequence and Known Sequence from PDB Search Using Fusion Gene Names

Multiple Sequence Alignment of the Longest Fusion Protein Sequence and Known Sequence from PDB Search Using Fusion Gene Names

Superimpose the 3D Structures Between the Longest Fusion Protein and the Longest Known PDB

3D view using mol* of viewer/superimpose_pdbs/CD74_NTRK1_8J5W_superimposed.pdb.html
3D view using mol* of viewer/superimpose_pdbs/CD74_NTRK1_8J5X_superimposed.pdb.html
3D view using mol* of viewer/superimpose_pdbs/CD74_NTRK1_8J61_superimposed.pdb.html
3D view using mol* of viewer/superimpose_pdbs/CD74_NTRK1_8J63_superimposed.pdb.html

Top

pLDDT score distribution

all_data/KinaseFusionDB_T_Results/KinaseFusionDB_T_ViolinPlots/90_CD74_NTRK1.png

pLDDT score distribution of the predicted fusion protein structures from AlphaFold2
* AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100.
* The blue color at the bottom marks the best active site residues.

90_CD74_NTRK1.png

Top

Potential Active Site Information

The potential binding sites of these fusion proteins were identified using SiteMap, a module of the Schrodinger suite.

Kinase Fusion AA seq ID in KinaseFusionDB

Site score

Size

Dscore

Volume

Exposure

Enclosure

Contact

Phobic

Philic

Balance

Don/Acc

Residues

Binding site residues of the found PDBs.

PDB accession	AA sequence	Residue position
8J5W	GLY	485
8J5W	LEU	486
8J5W	GLN	487
8J5W	GLY	488
8J5W	HIS	489
8J5W	ASP	499
8J5W	ALA	500
8J5W	CYS	501
8J5W	VAL	502
8J5W	HIS	503
8J5W	HIS	504
8J5W	ILE	505
8J5W	LYS	506
8J5W	ARG	507
8J5W	ARG	508
8J5W	ASP	509
8J5W	ILE	510
8J5W	VAL	511
8J5W	LEU	512
8J5W	LYS	513
8J5W	TRP	514
8J5W	GLU	515
8J5W	LEU	516
8J5W	GLY	517
8J5W	GLU	518
8J5W	GLY	519
8J5W	ALA	520
8J5W	PHE	521
8J5W	GLY	522
8J5W	LYS	523
8J5W	VAL	524
8J5W	PHE	525
8J5W	LEU	526
8J5W	ALA	527
8J5W	GLU	528
8J5W	CYS	529
8J5W	HIS	530
8J5W	ASN	531
8J5W	LEU	532
8J5W	LEU	533
8J5W	PRO	534
8J5W	GLU	535
8J5W	GLN	536
8J5W	ASP	537
8J5W	LYS	538
8J5W	MET	539
8J5W	LEU	540
8J5W	VAL	541
8J5W	ALA	542
8J5W	VAL	543
8J5W	LYS	544
8J5W	ALA	545
8J5W	LEU	546
8J5W	LYS	547
8J5W	GLU	548
8J5W	GLU	551
8J5W	SER	552
8J5W	ALA	553
8J5W	ARG	554
8J5W	GLN	555
8J5W	ASP	556
8J5W	PHE	557
8J5W	GLN	558
8J5W	ARG	559
8J5W	GLU	560
8J5W	ALA	561
8J5W	GLU	562
8J5W	LEU	563
8J5W	LEU	564
8J5W	THR	565
8J5W	MET	566
8J5W	LEU	567
8J5W	GLN	568
8J5W	HIS	569
8J5W	GLN	570
8J5W	HIS	571
8J5W	ILE	572
8J5W	VAL	573
8J5W	ARG	574
8J5W	PHE	575
8J5W	PHE	576
8J5W	GLY	577
8J5W	VAL	578
8J5W	CYS	579
8J5W	THR	580
8J5W	GLU	581
8J5W	GLY	582
8J5W	ARG	583
8J5W	PRO	584
8J5W	LEU	585
8J5W	LEU	586
8J5W	MET	587
8J5W	VAL	588
8J5W	LEU	589
8J5W	GLU	590
8J5W	TYR	591
8J5W	MET	592
8J5W	ARG	593
8J5W	HIS	594
8J5W	GLY	595
8J5W	ASP	596
8J5W	LEU	597
8J5W	ASN	598
8J5W	ARG	599
8J5W	PHE	600
8J5W	LEU	601
8J5W	ARG	602
8J5W	SER	603
8J5W	HIS	604
8J5W	GLY	605
8J5W	PRO	606
8J5W	ASP	607
8J5W	LEU	610
8J5W	LEU	611
8J5W	ALA	612
8J5W	GLY	613
8J5W	GLY	614
8J5W	GLU	615
8J5W	ASP	616
8J5W	VAL	617
8J5W	ALA	618
8J5W	PRO	619
8J5W	GLY	620
8J5W	PRO	621
8J5W	LEU	622
8J5W	GLY	623
8J5W	LEU	624
8J5W	GLY	625
8J5W	GLN	626
8J5W	LEU	627
8J5W	LEU	628
8J5W	ALA	629
8J5W	VAL	630
8J5W	ALA	631
8J5W	SER	632
8J5W	GLN	633
8J5W	VAL	634
8J5W	ALA	635
8J5W	ALA	636
8J5W	GLY	637
8J5W	MET	638
8J5W	VAL	639
8J5W	TYR	640
8J5W	LEU	641
8J5W	ALA	642
8J5W	GLY	643
8J5W	LEU	644
8J5W	HIS	645
8J5W	PHE	646
8J5W	VAL	647
8J5W	HIS	648
8J5W	ARG	649
8J5W	ASP	650
8J5W	LEU	651
8J5W	ALA	652
8J5W	THR	653
8J5W	ARG	654
8J5W	ASN	655
8J5W	CYS	656
8J5W	LEU	657
8J5W	VAL	658
8J5W	GLY	659
8J5W	GLN	660
8J5W	GLY	661
8J5W	LEU	662
8J5W	VAL	663
8J5W	VAL	664
8J5W	LYS	665
8J5W	ILE	666
8J5W	GLY	667
8J5W	ASP	668
8J5W	PHE	669
8J5W	GLY	670
8J5W	MET	671
8J5W	SER	672
8J5W	ARG	673
8J5W	ASP	674
8J5W	ILE	675
8J5W	TYR	676
8J5W	SER	677
8J5W	THR	678
8J5W	ASP	679
8J5W	TYR	680
8J5W	TYR	681
8J5W	ARG	682
8J5W	VAL	683
8J5W	GLY	684
8J5W	GLY	685
8J5W	ARG	686
8J5W	THR	687
8J5W	MET	688
8J5W	LEU	689
8J5W	PRO	690
8J5W	ILE	691
8J5W	ARG	692
8J5W	TRP	693
8J5W	MET	694
8J5W	PRO	695
8J5W	PRO	696
8J5W	GLU	697
8J5W	SER	698
8J5W	ILE	699
8J5W	LEU	700
8J5W	TYR	701
8J5W	ARG	702
8J5W	LYS	703
8J5W	PHE	704
8J5W	THR	705
8J5W	THR	706
8J5W	GLU	707
8J5W	SER	708
8J5W	ASP	709
8J5W	VAL	710
8J5W	TRP	711
8J5W	SER	712
8J5W	PHE	713
8J5W	GLY	714
8J5W	VAL	715
8J5W	VAL	716
8J5W	LEU	717
8J5W	TRP	718
8J5W	GLU	719
8J5W	ILE	720
8J5W	PHE	721
8J5W	THR	722
8J5W	TYR	723
8J5W	GLY	724
8J5W	LYS	725
8J5W	GLN	726
8J5W	PRO	727
8J5W	TRP	728
8J5W	TYR	729
8J5W	GLN	730
8J5W	LEU	731
8J5W	SER	732
8J5W	ASN	733
8J5W	THR	734
8J5W	GLU	735
8J5W	ALA	736
8J5W	ILE	737
8J5W	ASP	738
8J5W	CYS	739
8J5W	ILE	740
8J5W	THR	741
8J5W	GLN	742
8J5W	GLY	743
8J5W	ARG	744
8J5W	GLU	745
8J5W	LEU	746
8J5W	GLU	747
8J5W	ARG	748
8J5W	PRO	749
8J5W	ARG	750
8J5W	ALA	751
8J5W	CYS	752
8J5W	PRO	753
8J5W	PRO	754
8J5W	GLU	755
8J5W	VAL	756
8J5W	TYR	757
8J5W	ALA	758
8J5W	ILE	759
8J5W	MET	760
8J5W	ARG	761
8J5W	GLY	762
8J5W	CYS	763
8J5W	TRP	764
8J5W	GLN	765
8J5W	ARG	766
8J5W	GLU	767
8J5W	PRO	768
8J5W	GLN	769
8J5W	GLN	770
8J5W	ARG	771
8J5W	HIS	772
8J5W	SER	773
8J5W	ILE	774
8J5W	LYS	775
8J5W	ASP	776
8J5W	VAL	777
8J5W	HIS	778
8J5W	ALA	779
8J5W	ARG	780
8J5W	LEU	781
8J5W	GLN	782
8J5W	ALA	783
8J5W	LEU	784
8J5W	ALA	785
8J5W	GLN	786
8J5W	ALA	787
8J5W	PRO	788
8J5W	PRO	789
8J5W	VAL	790
8J5W	TYR	791
8J5W	LEU	792
8J5W	ASP	793
8J5W	VAL	794
8J5W	LEU	795
8J5X	ALA	500
8J5X	CYS	501
8J5X	VAL	502
8J5X	HIS	503
8J5X	HIS	504
8J5X	ILE	505
8J5X	LYS	506
8J5X	ARG	507
8J5X	ARG	508
8J5X	ASP	509
8J5X	ILE	510
8J5X	VAL	511
8J5X	LEU	512
8J5X	LYS	513
8J5X	TRP	514
8J5X	GLU	515
8J5X	LEU	516
8J5X	GLY	517
8J5X	GLU	518
8J5X	GLY	519
8J5X	ALA	520
8J5X	PHE	521
8J5X	GLY	522
8J5X	LYS	523
8J5X	VAL	524
8J5X	PHE	525
8J5X	LEU	526
8J5X	ALA	527
8J5X	GLU	528
8J5X	CYS	529
8J5X	HIS	530
8J5X	ASN	531
8J5X	LEU	532
8J5X	LEU	533
8J5X	PRO	534
8J5X	GLU	535
8J5X	GLN	536
8J5X	ASP	537
8J5X	LYS	538
8J5X	MET	539
8J5X	LEU	540
8J5X	VAL	541
8J5X	ALA	542
8J5X	VAL	543
8J5X	LYS	544
8J5X	ALA	545
8J5X	LEU	546
8J5X	LYS	547
8J5X	GLU	548
8J5X	ALA	549
8J5X	SER	550
8J5X	GLU	551
8J5X	SER	552
8J5X	ALA	553
8J5X	ARG	554
8J5X	GLN	555
8J5X	ASP	556
8J5X	PHE	557
8J5X	GLN	558
8J5X	ARG	559
8J5X	GLU	560
8J5X	ALA	561
8J5X	GLU	562
8J5X	LEU	563
8J5X	LEU	564
8J5X	THR	565
8J5X	MET	566
8J5X	LEU	567
8J5X	GLN	568
8J5X	HIS	569
8J5X	GLN	570
8J5X	HIS	571
8J5X	ILE	572
8J5X	VAL	573
8J5X	ARG	574
8J5X	PHE	575
8J5X	PHE	576
8J5X	GLY	577
8J5X	VAL	578
8J5X	CYS	579
8J5X	THR	580
8J5X	GLU	581
8J5X	GLY	582
8J5X	ARG	583
8J5X	PRO	584
8J5X	LEU	585
8J5X	LEU	586
8J5X	MET	587
8J5X	VAL	588
8J5X	PHE	589
8J5X	GLU	590
8J5X	TYR	591
8J5X	MET	592
8J5X	ARG	593
8J5X	HIS	594
8J5X	ARG	595
8J5X	ASP	596
8J5X	LEU	597
8J5X	ASN	598
8J5X	ARG	599
8J5X	PHE	600
8J5X	LEU	601
8J5X	ARG	602
8J5X	SER	603
8J5X	HIS	604
8J5X	GLY	605
8J5X	PRO	606
8J5X	ASP	607
8J5X	ALA	608
8J5X	LYS	609
8J5X	LEU	610
8J5X	LEU	611
8J5X	ALA	612
8J5X	GLY	613
8J5X	GLY	614
8J5X	GLU	615
8J5X	ASP	616
8J5X	VAL	617
8J5X	ALA	618
8J5X	PRO	619
8J5X	GLY	620
8J5X	PRO	621
8J5X	LEU	622
8J5X	GLY	623
8J5X	LEU	624
8J5X	GLY	625
8J5X	GLN	626
8J5X	LEU	627
8J5X	LEU	628
8J5X	ALA	629
8J5X	VAL	630
8J5X	ALA	631
8J5X	SER	632
8J5X	GLN	633
8J5X	VAL	634
8J5X	ALA	635
8J5X	ALA	636
8J5X	GLY	637
8J5X	MET	638
8J5X	VAL	639
8J5X	TYR	640
8J5X	LEU	641
8J5X	ALA	642
8J5X	GLY	643
8J5X	LEU	644
8J5X	HIS	645
8J5X	PHE	646
8J5X	VAL	647
8J5X	HIS	648
8J5X	ARG	649
8J5X	ASP	650
8J5X	LEU	651
8J5X	ALA	652
8J5X	THR	653
8J5X	ARG	654
8J5X	ASN	655
8J5X	CYS	656
8J5X	LEU	657
8J5X	VAL	658
8J5X	GLY	659
8J5X	GLN	660
8J5X	GLY	661
8J5X	LEU	662
8J5X	VAL	663
8J5X	VAL	664
8J5X	LYS	665
8J5X	ILE	666
8J5X	GLY	667
8J5X	ASP	668
8J5X	PHE	669
8J5X	GLY	670
8J5X	MET	671
8J5X	SER	672
8J5X	ARG	673
8J5X	ASP	674
8J5X	ILE	675
8J5X	TYR	676
8J5X	SER	677
8J5X	THR	678
8J5X	ASP	679
8J5X	TYR	680
8J5X	TYR	681
8J5X	ARG	682
8J5X	VAL	683
8J5X	GLY	684
8J5X	GLY	685
8J5X	ARG	686
8J5X	THR	687
8J5X	MET	688
8J5X	LEU	689
8J5X	PRO	690
8J5X	ILE	691
8J5X	ARG	692
8J5X	TRP	693
8J5X	MET	694
8J5X	PRO	695
8J5X	PRO	696
8J5X	GLU	697
8J5X	SER	698
8J5X	ILE	699
8J5X	LEU	700
8J5X	TYR	701
8J5X	ARG	702
8J5X	LYS	703
8J5X	PHE	704
8J5X	THR	705
8J5X	THR	706
8J5X	GLU	707
8J5X	SER	708
8J5X	ASP	709
8J5X	VAL	710
8J5X	TRP	711
8J5X	SER	712
8J5X	PHE	713
8J5X	GLY	714
8J5X	VAL	715
8J5X	VAL	716
8J5X	LEU	717
8J5X	TRP	718
8J5X	GLU	719
8J5X	ILE	720
8J5X	PHE	721
8J5X	THR	722
8J5X	TYR	723
8J5X	GLY	724
8J5X	LYS	725
8J5X	GLN	726
8J5X	PRO	727
8J5X	TRP	728
8J5X	TYR	729
8J5X	GLN	730
8J5X	LEU	731
8J5X	SER	732
8J5X	ASN	733
8J5X	THR	734
8J5X	GLU	735
8J5X	ALA	736
8J5X	ILE	737
8J5X	ASP	738
8J5X	CYS	739
8J5X	ILE	740
8J5X	THR	741
8J5X	GLN	742
8J5X	GLY	743
8J5X	ARG	744
8J5X	GLU	745
8J5X	LEU	746
8J5X	GLU	747
8J5X	ARG	748
8J5X	PRO	749
8J5X	ARG	750
8J5X	ALA	751
8J5X	CYS	752
8J5X	PRO	753
8J5X	PRO	754
8J5X	GLU	755
8J5X	VAL	756
8J5X	TYR	757
8J5X	ALA	758
8J5X	ILE	759
8J5X	MET	760
8J5X	ARG	761
8J5X	GLY	762
8J5X	CYS	763
8J5X	TRP	764
8J5X	GLN	765
8J5X	ARG	766
8J5X	GLU	767
8J5X	PRO	768
8J5X	GLN	769
8J5X	GLN	770
8J5X	ARG	771
8J5X	HIS	772
8J5X	SER	773
8J5X	ILE	774
8J5X	LYS	775
8J5X	ASP	776
8J5X	VAL	777
8J5X	HIS	778
8J5X	ALA	779
8J5X	ARG	780
8J5X	LEU	781
8J5X	GLN	782
8J5X	ALA	783
8J5X	LEU	784
8J5X	ALA	785
8J5X	GLN	786
8J5X	ALA	787
8J5X	PRO	788
8J5X	PRO	789
8J5X	VAL	790
8J5X	TYR	791
8J5X	LEU	792
8J5X	ASP	793
8J5X	VAL	794
8J5X	LEU	795
8J61	ASP	499
8J61	ALA	500
8J61	CYS	501
8J61	VAL	502
8J61	HIS	503
8J61	HIS	504
8J61	ILE	505
8J61	LYS	506
8J61	ARG	507
8J61	ARG	508
8J61	ASP	509
8J61	ILE	510
8J61	VAL	511
8J61	LEU	512
8J61	LYS	513
8J61	TRP	514
8J61	GLU	515
8J61	LEU	516
8J61	GLY	517
8J61	GLU	518
8J61	GLY	519
8J61	ALA	520
8J61	PHE	521
8J61	GLY	522
8J61	LYS	523
8J61	VAL	524
8J61	PHE	525
8J61	LEU	526
8J61	ALA	527
8J61	GLU	528
8J61	CYS	529
8J61	HIS	530
8J61	ASN	531
8J61	LEU	532
8J61	LEU	533
8J61	PRO	534
8J61	GLU	535
8J61	GLN	536
8J61	ASP	537
8J61	LYS	538
8J61	MET	539
8J61	LEU	540
8J61	VAL	541
8J61	ALA	542
8J61	VAL	543
8J61	LYS	544
8J61	ALA	545
8J61	LEU	546
8J61	LYS	547
8J61	SER	550
8J61	GLU	551
8J61	SER	552
8J61	ALA	553
8J61	ARG	554
8J61	GLN	555
8J61	ASP	556
8J61	PHE	557
8J61	GLN	558
8J61	ARG	559
8J61	GLU	560
8J61	ALA	561
8J61	GLU	562
8J61	LEU	563
8J61	LEU	564
8J61	THR	565
8J61	MET	566
8J61	LEU	567
8J61	GLN	568
8J61	HIS	569
8J61	GLN	570
8J61	HIS	571
8J61	ILE	572
8J61	VAL	573
8J61	ARG	574
8J61	PHE	575
8J61	PHE	576
8J61	GLY	577
8J61	VAL	578
8J61	CYS	579
8J61	THR	580
8J61	GLU	581
8J61	GLY	582
8J61	ARG	583
8J61	PRO	584
8J61	LEU	585
8J61	LEU	586
8J61	MET	587
8J61	VAL	588
8J61	PHE	589
8J61	GLU	590
8J61	TYR	591
8J61	MET	592
8J61	ARG	593
8J61	HIS	594
8J61	GLY	595
8J61	ASP	596
8J61	LEU	597
8J61	ASN	598
8J61	ARG	599
8J61	PHE	600
8J61	LEU	601
8J61	ARG	602
8J61	SER	603
8J61	HIS	604
8J61	GLY	605
8J61	PRO	606
8J61	ASP	607
8J61	ALA	612
8J61	GLY	613
8J61	GLY	614
8J61	GLU	615
8J61	ASP	616
8J61	VAL	617
8J61	ALA	618
8J61	PRO	619
8J61	GLY	620
8J61	PRO	621
8J61	LEU	622
8J61	GLY	623
8J61	LEU	624
8J61	GLY	625
8J61	GLN	626
8J61	LEU	627
8J61	LEU	628
8J61	ALA	629
8J61	VAL	630
8J61	ALA	631
8J61	SER	632
8J61	GLN	633
8J61	VAL	634
8J61	ALA	635
8J61	ALA	636
8J61	GLY	637
8J61	MET	638
8J61	VAL	639
8J61	TYR	640
8J61	LEU	641
8J61	ALA	642
8J61	GLY	643
8J61	LEU	644
8J61	HIS	645
8J61	PHE	646
8J61	VAL	647
8J61	HIS	648
8J61	ARG	649
8J61	ASP	650
8J61	LEU	651
8J61	ALA	652
8J61	THR	653
8J61	ARG	654
8J61	ASN	655
8J61	CYS	656
8J61	LEU	657
8J61	VAL	658
8J61	GLY	659
8J61	GLN	660
8J61	GLY	661
8J61	LEU	662
8J61	VAL	663
8J61	VAL	664
8J61	LYS	665
8J61	ILE	666
8J61	GLY	667
8J61	ASP	668
8J61	PHE	669
8J61	GLY	670
8J61	MET	671
8J61	SER	672
8J61	ARG	673
8J61	ASP	674
8J61	ILE	675
8J61	TYR	676
8J61	SER	677
8J61	THR	678
8J61	ASP	679
8J61	TYR	680
8J61	TYR	681
8J61	ARG	682
8J61	VAL	683
8J61	GLY	684
8J61	GLY	685
8J61	ARG	686
8J61	THR	687
8J61	MET	688
8J61	LEU	689
8J61	PRO	690
8J61	ILE	691
8J61	ARG	692
8J61	TRP	693
8J61	MET	694
8J61	PRO	695
8J61	PRO	696
8J61	GLU	697
8J61	SER	698
8J61	ILE	699
8J61	LEU	700
8J61	TYR	701
8J61	ARG	702
8J61	LYS	703
8J61	PHE	704
8J61	THR	705
8J61	THR	706
8J61	GLU	707
8J61	SER	708
8J61	ASP	709
8J61	VAL	710
8J61	TRP	711
8J61	SER	712
8J61	PHE	713
8J61	GLY	714
8J61	VAL	715
8J61	VAL	716
8J61	LEU	717
8J61	TRP	718
8J61	GLU	719
8J61	ILE	720
8J61	PHE	721
8J61	THR	722
8J61	TYR	723
8J61	GLY	724
8J61	LYS	725
8J61	GLN	726
8J61	PRO	727
8J61	TRP	728
8J61	TYR	729
8J61	GLN	730
8J61	LEU	731
8J61	SER	732
8J61	ASN	733
8J61	THR	734
8J61	GLU	735
8J61	ALA	736
8J61	ILE	737
8J61	ASP	738
8J61	CYS	739
8J61	ILE	740
8J61	THR	741
8J61	GLN	742
8J61	GLY	743
8J61	ARG	744
8J61	GLU	745
8J61	LEU	746
8J61	GLU	747
8J61	ARG	748
8J61	PRO	749
8J61	ARG	750
8J61	ALA	751
8J61	CYS	752
8J61	PRO	753
8J61	PRO	754
8J61	GLU	755
8J61	VAL	756
8J61	TYR	757
8J61	ALA	758
8J61	ILE	759
8J61	MET	760
8J61	ARG	761
8J61	GLY	762
8J61	CYS	763
8J61	TRP	764
8J61	GLN	765
8J61	ARG	766
8J61	GLU	767
8J61	PRO	768
8J61	GLN	769
8J61	GLN	770
8J61	ARG	771
8J61	HIS	772
8J61	SER	773
8J61	ILE	774
8J61	LYS	775
8J61	ASP	776
8J61	VAL	777
8J61	HIS	778
8J61	ALA	779
8J61	ARG	780
8J61	LEU	781
8J61	GLN	782
8J61	ALA	783
8J61	LEU	784
8J61	ALA	785
8J61	GLN	786
8J61	ALA	787
8J61	PRO	788
8J61	PRO	789
8J61	VAL	790
8J61	TYR	791
8J61	LEU	792
8J61	ASP	793
8J61	VAL	794
8J61	LEU	795

Top

Ramachandran Plot of Kinase Fusion Protein Structure

Ramachandran plot of the torsional angles - phi (φ)and psi (ψ) - of the residues (amino acids) contained in this fusion protein peptide.

90_CD74_NTRK1_ramachandran.png

Top

Virtual Screening Results

Distribution of the average docking score across all approved kinase inhibitors.
Distribution of the number of occurrence across all approved kinase inhibitors.

5'-kinase fusion protein case

3'-kinase fusion protein case

Top

Drug information from DrugBank of the top 20 interacting small molecules.
* The detailed information of individual kinase inhibitors are available in the download page.

Fusion gene name info	Drug	Docking score	Glide g score	Glide energy
90_CD74_NTRK1-DOCK_HTVS_1-001	Pralsetinib	-7.09191	-7.18341	-50.6107
90_CD74_NTRK1-DOCK_HTVS_1-001	Axitinib	-6.09734	-6.1005400000000005	-36.2044
90_CD74_NTRK1-DOCK_HTVS_1-001	Brigatinib	-5.818969999999999	-5.83247	-45.3354
90_CD74_NTRK1-DOCK_HTVS_1-001	Brigatinib	-5.818969999999999	-5.83247	-45.3354
90_CD74_NTRK1-DOCK_HTVS_1-001	Ibrutinib	-5.65527	-5.65527	-37.7137
90_CD74_NTRK1-DOCK_HTVS_1-001	Lapatinib	-5.65335	-5.74215	-52.5611
90_CD74_NTRK1-DOCK_HTVS_1-001	Netarsudil	-5.62265	-5.63375	-26.6648
90_CD74_NTRK1-DOCK_HTVS_1-001	Netarsudil	-5.62265	-5.63375	-26.6648
90_CD74_NTRK1-DOCK_HTVS_1-001	Pralsetinib	-5.5008300000000006	-5.5923300000000005	-47.8312
90_CD74_NTRK1-DOCK_HTVS_1-001	Selpercatinib	-5.496519999999999	-5.527019999999999	-53.5853
90_CD74_NTRK1-DOCK_HTVS_1-001	Temsirolimus	-5.42114	-5.422540000000001	-42.3143
90_CD74_NTRK1-DOCK_HTVS_1-001	Tepotinib	-5.32176	-5.3228599999999995	-49.583
90_CD74_NTRK1-DOCK_HTVS_1-001	Temsirolimus	-5.30719	-5.308590000000001	-42.7553
90_CD74_NTRK1-DOCK_HTVS_1-001	Netarsudil	-5.303999999999999	-5.3151	-46.6796
90_CD74_NTRK1-DOCK_HTVS_1-001	Netarsudil	-5.303999999999999	-5.3151	-46.6796
90_CD74_NTRK1-DOCK_HTVS_1-001	Ripretinib	-5.29571	-5.30271	-48.489
90_CD74_NTRK1-DOCK_HTVS_1-001	Ripretinib	-5.29571	-5.30271	-48.489
90_CD74_NTRK1-DOCK_HTVS_1-001	Pralsetinib	-5.27915	-5.37065	-47.0029
90_CD74_NTRK1-DOCK_HTVS_1-001	Everolimus	-5.26999	-5.27139	-46.7506
90_CD74_NTRK1-DOCK_HTVS_1-001	Selpercatinib	-5.24332	-5.27382	-46.4892

Top

Kinase-Substrate Information of CD74_NTRK1

Phosphorylation target of the kinase
(phosphosite, 03-17-2024)

Kinase	Kinase UniProt Acc	Kinase species	Substrate	Substrate UniProt Acc	Substrate phosphorylated residues	Substrate phosphorylated sites (+/-7AA)	Domain
NTRK1	P04629	human	SH2B1	Q9NRF2	Y753	PRAINNQySFV____
NTRK1	P04629	human	CTNNB1	P35222	Y142	AVVNLINyQDDAELA
NTRK1	P04629	human	NTRK1	P04629-2	Y490	HIIENPQyFSDACVH
NTRK1	P04629	human	NTRK1	P04629-2	Y674	RDIySTDyyRVGGRT	PK_Tyr_Ser-Thr
NTRK1	P04629	human	NTRK1	P04629	Y680	RDIySTDyyRVGGRT	PK_Tyr_Ser-Thr
NTRK1	P04629	human	SHC3	Q92529-2	Y218	GDGSDHPyyNSIPSK
NTRK1	P04629	human	SHC3	Q92529-2	Y256	FAGKEQTyyQGRHLG
NTRK1	P04629	human	NTRK1	P04629-2	Y670	FGMSRDIySTDyyRV	PK_Tyr_Ser-Thr
NTRK1	P04629	human	NTRK1	P04629	Y496	HIIENPQyFSDACVH
NTRK1	P04629	human	STAT3	P40763	Y705	DPGsAAPyLktKFIC
NTRK1	P04629	human	SHC1	P29353-2	Y317	ELFDDPSyVNVQNLD
NTRK1	P04629	human	PLCG1	P19174	Y771	IGtAEPdyGALyEGR
NTRK1	P04629	human	PLCG1	P19174	Y783	EGRNPGFyVEANPMP
NTRK1	P04629	human	NTRK1	P04629-2	Y675	DIySTDyyRVGGRTM	PK_Tyr_Ser-Thr
NTRK1	P04629	human	NTRK1	P04629-2	Y751	RACPPEVyAIMRGCW	PK_Tyr_Ser-Thr
NTRK1	P04629	human	NTRK1	P04629	Y681	DIySTDyyRVGGRTM	PK_Tyr_Ser-Thr
NTRK1	P04629	human	NTRK1	P04629-2	Y785	LAQAPPVyLDVLG__
NTRK1	P04629	human	SHC3	Q92529-2	Y301	PTGEAPTyVNTQQIP
NTRK1	P04629	human	SHC3	Q92529-2	Y257	AGKEQTyyQGRHLGD
NTRK1	P04629	human	SHC3	Q92529-2	Y283	RQGSSDIySTPEGKL
NTRK1	P04629	human	SHC3	Q92529-2	Y219	DGSDHPyyNSIPSKM

Biological Network Integration of This Kinase and Substrates
(GeneMANIA website)

Enriched GO biological processes of the phosphorylation target genes of the kinase

Kinase	GOID	GO term	P.adjust
NTRK1	ID	Description	0.00e+00
NTRK1	GO:0007173	epidermal growth factor receptor signaling pathway	3.89e-03
NTRK1	GO:0038127	ERBB signaling pathway	3.89e-03
NTRK1	GO:0048485	sympathetic nervous system development	7.40e-03
NTRK1	GO:1905564	positive regulation of vascular endothelial cell proliferation	8.42e-03
NTRK1	GO:0050679	positive regulation of epithelial cell proliferation	8.42e-03
NTRK1	GO:0051091	positive regulation of DNA-binding transcription factor activity	9.81e-03
NTRK1	GO:0048483	autonomic nervous system development	1.32e-02
NTRK1	GO:0101023	vascular endothelial cell proliferation	1.32e-02
NTRK1	GO:1905562	regulation of vascular endothelial cell proliferation	1.32e-02
NTRK1	GO:0050982	detection of mechanical stimulus	1.32e-02
NTRK1	GO:0045765	regulation of angiogenesis	1.43e-02
NTRK1	GO:1901342	regulation of vasculature development	1.43e-02
NTRK1	GO:0021545	cranial nerve development	1.43e-02
NTRK1	GO:0051090	regulation of DNA-binding transcription factor activity	1.78e-02
NTRK1	GO:0050678	regulation of epithelial cell proliferation	1.78e-02
NTRK1	GO:0030098	lymphocyte differentiation	1.95e-02
NTRK1	GO:0043410	positive regulation of MAPK cascade	2.21e-02
NTRK1	GO:0050673	epithelial cell proliferation	2.21e-02
NTRK1	GO:1903131	mononuclear cell differentiation	2.21e-02
NTRK1	GO:0021675	nerve development	2.21e-02
NTRK1	GO:0001938	positive regulation of endothelial cell proliferation	2.65e-02
NTRK1	GO:0032355	response to estradiol	2.65e-02
NTRK1	GO:0051963	regulation of synapse assembly	2.65e-02
NTRK1	GO:2000278	regulation of DNA biosynthetic process	2.67e-02
NTRK1	GO:0048593	camera-type eye morphogenesis	3.31e-02
NTRK1	GO:0009581	detection of external stimulus	3.42e-02
NTRK1	GO:0009582	detection of abiotic stimulus	3.44e-02
NTRK1	GO:0051092	positive regulation of NF-kappaB transcription factor activity	3.62e-02
NTRK1	GO:0048592	eye morphogenesis	3.62e-02
NTRK1	GO:0043524	negative regulation of neuron apoptotic process	3.62e-02
NTRK1	GO:0046661	male sex differentiation	3.62e-02
NTRK1	GO:0001764	neuron migration	3.62e-02
NTRK1	GO:0001936	regulation of endothelial cell proliferation	3.62e-02
NTRK1	GO:0019827	stem cell population maintenance	3.62e-02
NTRK1	GO:0045766	positive regulation of angiogenesis	3.62e-02
NTRK1	GO:1904018	positive regulation of vasculature development	3.62e-02
NTRK1	GO:0098727	maintenance of cell number	3.62e-02
NTRK1	GO:0071897	DNA biosynthetic process	3.62e-02
NTRK1	GO:0007416	synapse assembly	3.62e-02
NTRK1	GO:0001935	endothelial cell proliferation	3.62e-02
NTRK1	GO:0050728	negative regulation of inflammatory response	3.62e-02
NTRK1	GO:0009612	response to mechanical stimulus	3.62e-02
NTRK1	GO:0045637	regulation of myeloid cell differentiation	3.62e-02
NTRK1	GO:1901888	regulation of cell junction assembly	3.62e-02
NTRK1	GO:0070374	positive regulation of ERK1 and ERK2 cascade	3.62e-02
NTRK1	GO:0043523	regulation of neuron apoptotic process	3.62e-02
NTRK1	GO:0050807	regulation of synapse organization	3.62e-02
NTRK1	GO:0048863	stem cell differentiation	3.62e-02
NTRK1	GO:0050803	regulation of synapse structure or activity	3.62e-02

Top

Related Drugs to CD74_NTRK1

Drugs used for this fusion-positive patient.
(Manual curation of PubMed, 04-30-2022 + MyCancerGenome)

Hgene

Tgene

Drug

Source

PMID

Distribution of the number of studies mentioning CD74-NTRK1 and kinase inhibitors the PubMed Abstract (04-01-2024)

Fusion gene - drug pair 1

Fusion gene - drug pair 2

PMID

Publication date

DOI

Study title

Top

Related Diseases to CD74_NTRK1

Diseases that have this fusion gene.
(Manual curation of PubMed, 04-30-2022 + MyCancerGenome)

Hgene

Tgene

Disease

Source

PMID

Related diseases from the literature mentioned this fusion gene and drug.
(PubMed, 04-01-2024)

MeSH ID

MeSH term

Diseases associated with fusion partners.
(DisGeNet 4.0)

Partner	Gene	Disease ID	Disease name	# pubmeds	Source
Tgene	NTRK1	C0020074	HSAN Type IV	17	CTD_human;GENOMICS_ENGLAND;UNIPROT
Tgene	NTRK1	C0238463	Papillary thyroid carcinoma	3	ORPHANET

Top

Clinical Trials of the Found Drugs/Small Molecules

Statistics of the Clinical Trials of the Found Kinase Inibitors from clinicaltrials.gov (06-17-2024)

Clinical Trials from clinicaltrials.gov (06-17-2024)

Fusion Gene

Kinase Inhibitor

NCT ID

Study Status

Phases

Disease

# Enrolment

Date