| UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
|
|||||||
|
Fusion Protein:AGPAT5-KCNU1 |
Fusion Protein Summary |
Fusion gene summary |
| Fusion partner gene information | Fusion gene name: AGPAT5-KCNU1 | FusionPDB ID: 2964 | FusionGDB2.0 ID: 2964 | Hgene | Tgene | Gene symbol | AGPAT5 | KCNU1 | Gene ID | 55326 | 157855 |
| Gene name | 1-acylglycerol-3-phosphate O-acyltransferase 5 | potassium calcium-activated channel subfamily U member 1 | |
| Synonyms | 1AGPAT5|LPAATE | KCNMC1|KCa5|KCa5.1|Kcnma3|Slo3 | |
| Cytomap | 8p23.1 | 8p11.23 | |
| Type of gene | protein-coding | protein-coding | |
| Description | 1-acyl-sn-glycerol-3-phosphate acyltransferase epsilon1-AGP acyltransferase 51-AGPAT 51-acylglycerol-3-phosphate O-acyltransferase 5 (lysophosphatidic acid acyltransferase, epsilon)lysophosphatidic acid acyltransferase epsilontesticular tissue protei | potassium channel subfamily U member 1Calcium-activated potassium channel subunit alpha-3Calcium-activated potassium channel, subfamily M subunit alpha-3Slowpoke homolog 3potassium channel, subfamily U, member 1 | |
| Modification date | 20200313 | 20200313 | |
| UniProtAcc | Q9NUQ2 | A8MYU2 | |
| Ensembl transtripts involved in fusion gene | ENST ids | ENST00000530716, ENST00000285518, | ENST00000399881, ENST00000518904, |
| Fusion gene scores for assessment (based on all fusion genes of FusionGDB 2.0) | * DoF score | 9 X 7 X 6=378 | 8 X 7 X 7=392 |
| # samples | 9 | 11 | |
| ** MAII score | log2(9/378*10)=-2.0703893278914 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | log2(11/392*10)=-1.83335013059055 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | |
| Context (manual curation of fusion genes in FusionPDB) | PubMed: AGPAT5 [Title/Abstract] AND KCNU1 [Title/Abstract] AND fusion [Title/Abstract] | ||
| Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) | AGPAT5(6599272)-KCNU1(36721922), # samples:1 | ||
| Anticipated loss of major functional domain due to fusion event. | AGPAT5-KCNU1 seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. AGPAT5-KCNU1 seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. AGPAT5-KCNU1 seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. AGPAT5-KCNU1 seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. | ||
| * DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Partner | Gene | GO ID | GO term | PubMed ID |
Fusion gene breakpoints across AGPAT5 (5'-gene)* Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
![]() |
Fusion gene breakpoints across KCNU1 (3'-gene)* Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
![]() |
Top |
Fusion Gene Sample Information |
Fusion gene information from FusionGDB2.0. |
Fusion gene information from two resources (ChiTars 5.0 and ChimerDB 4.0)* All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
| Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
| ChimerDB4 | HNSC | TCGA-CV-7446-01A | AGPAT5 | chr8 | 6599272 | - | KCNU1 | chr8 | 36721922 | + |
Top |
Fusion ORF Analysis |
Fusion information from ORFfinder translation from full-length transcript sequence from FusionPDB. |
| Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
| ENST00000285518 | AGPAT5 | chr8 | 6599272 | - | ENST00000399881 | KCNU1 | chr8 | 36721922 | + | 2665 | 898 | 231 | 2456 | 741 |
DeepORF prediction of the coding potential based on the fusion transcript sequence of in-frame fusion genes. DeepORF is a coding potential classifier based on convolutional neural network by comparing the real Ribo-seq data. If the no-coding score < 0.5 and coding score > 0.5, then the in-frame fusion transcript is predicted as being likely translated. |
| Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
| ENST00000285518 | ENST00000399881 | AGPAT5 | chr8 | 6599272 | - | KCNU1 | chr8 | 36721922 | + | 0.004630562 | 0.9953694 |
Top |
Fusion Amino Acid Sequences |
For individual full-length fusion transcript sequence from FusionPDB, we ran ORFfinder and chose the longest ORF among the all predicted ones. |
| >FusionGDB ID_FusionGDB isoform ID_FGname_Hgene_Hchr_Hbp_Henst_Tgene_Tchr_Tbp_Tenst_length(fusion AA) seq_BP >2964_2964_1_AGPAT5-KCNU1_AGPAT5_chr8_6599272_ENST00000285518_KCNU1_chr8_36721922_ENST00000399881_length(amino acids)=741AA_BP=222 MAACWPRLRPGRRAGSAGGARCRRAEKMLLSLVLHTYSMRYLLPSVVLLGTAPTYVLAWGVWRLLSAFLPARFYQALDDRLYCVYQSMVL FFFENYTGVQILLYGDLPKNKENIIYLANHQSTVDWIVADILAIRQNALGHVRYVLKEGLKWLPLYGCYFAQHGGIYVKRSAKFNEKEMR NKLQSYVDAGTPMYLVIFPEGTRYNPEQTKVLSASQAFAAQRVPSVKRMKKCLKGISSRISGQDSPPRVSASTSSISNFTTRTLQHDVEQ DSDQLDSSGMFHWCKPTSLDKVTLKRTGKSKYKFRNHIVACVFGDAHSAPMGLRNFVMPLRASNYTRKELKDIVFIGSLDYLQREWRFLW NFPQIYILPGCALYSGDLHAANIEQCSMCAVLSPPPQPSSNQTLVDTEAIMATLTIGSLQIDSSSDPSPSVSEETPGYTNGHNEKSNCRK VPILTELKNPSNIHFIEQLGGLEGSLQETNLHLSTAFSTGTVFSGSFLDSLLATAFYNYHVLELLQMLVTGGVSSQLEQHLDKDKVYGVA DSCTSLLSGRNRCKLGLLSLHETILSDVNPRNTFGQLFCGSLDLFGILCVGLYRIIDEEELNPENKRFVITRPANEFKLLPSDLVFCAIP FSTACYKRNEEFSLQKSYEIVNKASQTTETHSDTNCPPTIDSVTETLYSPVYSYQPRTNSLSFPKQIAWNQSRTNSIISSQIPLGDNAKE -------------------------------------------------------------- |
Top |
Fusion Protein Functional Features |
Four levels of functional features of fusion genesGo to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr8:6599272/chr8:36721922) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
![]() |
Main function of each fusion partner protein. (from UniProt) |
| Hgene | Tgene |
| AGPAT5 | KCNU1 |
| FUNCTION: Converts 1-acyl-sn-glycerol-3-phosphate (lysophosphatidic acid or LPA) into 1,2-diacyl-sn-glycerol-3-phosphate (phosphatidic acid or PA) by incorporating an acyl moiety at the sn-2 position of the glycerol backbone (PubMed:21173190). Acts on LPA containing saturated or unsaturated fatty acids C15:0-C20:4 at the sn-1 position using C18:1-CoA as the acyl donor (PubMed:21173190). Also acts on lysophosphatidylethanolamine using oleoyl-CoA, but not arachidonoyl-CoA, and lysophosphatidylinositol using arachidonoyl-CoA, but not oleoyl-CoA (PubMed:21173190). Activity toward lysophosphatidylglycerol not detectable (PubMed:21173190). {ECO:0000269|PubMed:21173190}. | FUNCTION: Testis-specific potassium channel activated by both intracellular pH and membrane voltage that mediates export of K(+). May represent the primary spermatozoan K(+) current. In contrast to KCNMA1/SLO1, it is not activated by Ca(2+) or Mg(2+). Critical for fertility. May play an important role in sperm osmoregulation required for the acquisition of normal morphology and motility when faced with osmotic challenges, such as those experienced after mixing with seminal fluid and entry into the vagina. {ECO:0000269|PubMed:23129643}. |
Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
| - Retained protein feature among the 13 regional features. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
| Hgene | AGPAT5 | chr8:6599272 | chr8:36721922 | ENST00000285518 | - | 5 | 8 | 93_98 | 195.33333333333334 | 365.0 | Motif | HXXXXD motif |
| Hgene | AGPAT5 | chr8:6599272 | chr8:36721922 | ENST00000285518 | - | 5 | 8 | 15_35 | 195.33333333333334 | 365.0 | Transmembrane | Helical |
| Hgene | AGPAT5 | chr8:6599272 | chr8:36721922 | ENST00000285518 | - | 5 | 8 | 61_81 | 195.33333333333334 | 365.0 | Transmembrane | Helical |
| Tgene | KCNU1 | chr8:6599272 | chr8:36721922 | ENST00000399881 | 17 | 27 | 711_731 | 630.3333333333334 | 1150.0 | Region | Note=Segment S9 | |
| Tgene | KCNU1 | chr8:6599272 | chr8:36721922 | ENST00000399881 | 17 | 27 | 895_915 | 630.3333333333334 | 1150.0 | Region | Note=Segment S10 |
| - Not-retained protein feature among the 13 regional features. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
| Hgene | AGPAT5 | chr8:6599272 | chr8:36721922 | ENST00000285518 | - | 5 | 8 | 344_364 | 195.33333333333334 | 365.0 | Transmembrane | Helical |
| Tgene | KCNU1 | chr8:6599272 | chr8:36721922 | ENST00000399881 | 17 | 27 | 339_482 | 630.3333333333334 | 1150.0 | Domain | Note=RCK N-terminal | |
| Tgene | KCNU1 | chr8:6599272 | chr8:36721922 | ENST00000399881 | 17 | 27 | 260_282 | 630.3333333333334 | 1150.0 | Intramembrane | Pore-forming%3B Name%3DP region | |
| Tgene | KCNU1 | chr8:6599272 | chr8:36721922 | ENST00000399881 | 17 | 27 | 276_279 | 630.3333333333334 | 1150.0 | Motif | Note=Selectivity for potassium | |
| Tgene | KCNU1 | chr8:6599272 | chr8:36721922 | ENST00000399881 | 17 | 27 | 480_500 | 630.3333333333334 | 1150.0 | Region | Note=Segment S7 | |
| Tgene | KCNU1 | chr8:6599272 | chr8:36721922 | ENST00000399881 | 17 | 27 | 537_557 | 630.3333333333334 | 1150.0 | Region | Note=Segment S8 | |
| Tgene | KCNU1 | chr8:6599272 | chr8:36721922 | ENST00000399881 | 17 | 27 | 123_138 | 630.3333333333334 | 1150.0 | Topological domain | Extracellular | |
| Tgene | KCNU1 | chr8:6599272 | chr8:36721922 | ENST00000399881 | 17 | 27 | 160_163 | 630.3333333333334 | 1150.0 | Topological domain | Cytoplasmic | |
| Tgene | KCNU1 | chr8:6599272 | chr8:36721922 | ENST00000399881 | 17 | 27 | 185_188 | 630.3333333333334 | 1150.0 | Topological domain | Extracellular | |
| Tgene | KCNU1 | chr8:6599272 | chr8:36721922 | ENST00000399881 | 17 | 27 | 1_24 | 630.3333333333334 | 1150.0 | Topological domain | Extracellular | |
| Tgene | KCNU1 | chr8:6599272 | chr8:36721922 | ENST00000399881 | 17 | 27 | 210_226 | 630.3333333333334 | 1150.0 | Topological domain | Cytoplasmic | |
| Tgene | KCNU1 | chr8:6599272 | chr8:36721922 | ENST00000399881 | 17 | 27 | 248_259 | 630.3333333333334 | 1150.0 | Topological domain | Extracellular | |
| Tgene | KCNU1 | chr8:6599272 | chr8:36721922 | ENST00000399881 | 17 | 27 | 283_291 | 630.3333333333334 | 1150.0 | Topological domain | Extracellular | |
| Tgene | KCNU1 | chr8:6599272 | chr8:36721922 | ENST00000399881 | 17 | 27 | 313_1149 | 630.3333333333334 | 1150.0 | Topological domain | Cytoplasmic | |
| Tgene | KCNU1 | chr8:6599272 | chr8:36721922 | ENST00000399881 | 17 | 27 | 46_101 | 630.3333333333334 | 1150.0 | Topological domain | Cytoplasmic | |
| Tgene | KCNU1 | chr8:6599272 | chr8:36721922 | ENST00000399881 | 17 | 27 | 102_122 | 630.3333333333334 | 1150.0 | Transmembrane | Helical%3B Name%3DSegment S1 | |
| Tgene | KCNU1 | chr8:6599272 | chr8:36721922 | ENST00000399881 | 17 | 27 | 139_159 | 630.3333333333334 | 1150.0 | Transmembrane | Helical%3B Name%3DSegment S2 | |
| Tgene | KCNU1 | chr8:6599272 | chr8:36721922 | ENST00000399881 | 17 | 27 | 164_184 | 630.3333333333334 | 1150.0 | Transmembrane | Helical%3B Name%3DSegment S3 | |
| Tgene | KCNU1 | chr8:6599272 | chr8:36721922 | ENST00000399881 | 17 | 27 | 189_209 | 630.3333333333334 | 1150.0 | Transmembrane | Helical%3B Voltage-sensor%3B Name%3DSegment S4 | |
| Tgene | KCNU1 | chr8:6599272 | chr8:36721922 | ENST00000399881 | 17 | 27 | 227_247 | 630.3333333333334 | 1150.0 | Transmembrane | Helical%3B Name%3DSegment S5 | |
| Tgene | KCNU1 | chr8:6599272 | chr8:36721922 | ENST00000399881 | 17 | 27 | 25_45 | 630.3333333333334 | 1150.0 | Transmembrane | Helical%3B Name%3DSegment S0 | |
| Tgene | KCNU1 | chr8:6599272 | chr8:36721922 | ENST00000399881 | 17 | 27 | 292_312 | 630.3333333333334 | 1150.0 | Transmembrane | Helical%3B Name%3DSegment S6 |
Top |
Fusion Protein-Protein Interaction |
Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in |
Protein-protein interactors with each fusion partner protein in wild-type from validated records (BIOGRID-3.4.160) |
| Gene | PPI interactors |
Protein-protein interactors based on sequence similarity (STRING) |
| Gene | STRING network |
| AGPAT5 | |
| KCNU1 |
- Retained interactions in fusion protein (protein functional feature from UniProt). |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
- Lost interactions due to fusion (protein functional feature from UniProt). |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
Related Drugs to AGPAT5-KCNU1 |
Drugs used for this fusion-positive patient. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
| Hgene | Tgene | Drug | Source | PMID |
Top |
Related Diseases to AGPAT5-KCNU1 |
Diseases that have this fusion gene. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
| Hgene | Tgene | Disease | Source | PMID |
Diseases associated with fusion partners. (DisGeNet 4.0) |
| Partner | Gene | Disease ID | Disease name | # pubmeds | Source |