| UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
|
|||||||
|
Fusion Protein:FOXO1-UBQLN1 |
Fusion Protein Summary |
Fusion gene summary |
| Fusion partner gene information | Fusion gene name: FOXO1-UBQLN1 | FusionPDB ID: 31171 | FusionGDB2.0 ID: 31171 | Hgene | Tgene | Gene symbol | FOXO1 | UBQLN1 | Gene ID | 2308 | 29979 |
| Gene name | forkhead box O1 | ubiquilin 1 | |
| Synonyms | FKH1|FKHR|FOXO1A | DA41|DSK2|PLIC-1|UBQN|XDRP1 | |
| Cytomap | 13q14.11 | 9q21.32|9q21.2-q21.3 | |
| Type of gene | protein-coding | protein-coding | |
| Description | forkhead box protein O1forkhead box protein O1Aforkhead, Drosophila, homolog of, in rhabdomyosarcoma | ubiquilin-1hPLIC-1protein linking IAP with cytoskeleton 1testicular tissue protein Li 219 | |
| Modification date | 20200322 | 20200327 | |
| UniProtAcc | Q12778 | . | |
| Ensembl transtripts involved in fusion gene | ENST ids | ENST00000379561, ENST00000473775, | ENST00000257468, ENST00000376395, |
| Fusion gene scores for assessment (based on all fusion genes of FusionGDB 2.0) | * DoF score | 13 X 12 X 9=1404 | 15 X 10 X 9=1350 |
| # samples | 16 | 19 | |
| ** MAII score | log2(16/1404*10)=-3.1333991254172 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | log2(19/1350*10)=-2.82888808360725 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | |
| Context (manual curation of fusion genes in FusionPDB) | PubMed: FOXO1 [Title/Abstract] AND UBQLN1 [Title/Abstract] AND fusion [Title/Abstract] | ||
| Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) | FOXO1(41239719)-UBQLN1(86280060), # samples:1 | ||
| Anticipated loss of major functional domain due to fusion event. | FOXO1-UBQLN1 seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. FOXO1-UBQLN1 seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. FOXO1-UBQLN1 seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. FOXO1-UBQLN1 seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. | ||
| * DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Partner | Gene | GO ID | GO term | PubMed ID |
| Hgene | FOXO1 | GO:0009267 | cellular response to starvation | 20543840 |
| Hgene | FOXO1 | GO:0032873 | negative regulation of stress-activated MAPK cascade | 19696738 |
| Hgene | FOXO1 | GO:0043066 | negative regulation of apoptotic process | 10871843 |
| Hgene | FOXO1 | GO:0045893 | positive regulation of transcription, DNA-templated | 7862145|10871843|12228231 |
| Hgene | FOXO1 | GO:0045944 | positive regulation of transcription by RNA polymerase II | 10871843|12228231 |
| Hgene | FOXO1 | GO:0071455 | cellular response to hyperoxia | 20543840 |
| Tgene | UBQLN1 | GO:0031396 | regulation of protein ubiquitination | 12634373 |
| Tgene | UBQLN1 | GO:0031398 | positive regulation of protein ubiquitination | 23307288 |
| Tgene | UBQLN1 | GO:0035973 | aggrephagy | 21143716 |
Fusion gene breakpoints across FOXO1 (5'-gene)* Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
![]() |
Fusion gene breakpoints across UBQLN1 (3'-gene)* Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
![]() |
Top |
Fusion Gene Sample Information |
Fusion gene information from FusionGDB2.0. |
Fusion gene information from two resources (ChiTars 5.0 and ChimerDB 4.0)* All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
| Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
| ChimerDB4 | STAD | TCGA-BR-A453 | FOXO1 | chr13 | 41239719 | - | UBQLN1 | chr9 | 86280060 | - |
Top |
Fusion ORF Analysis |
Fusion information from ORFfinder translation from full-length transcript sequence from FusionPDB. |
| Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
| ENST00000379561 | FOXO1 | chr13 | 41239719 | - | ENST00000376395 | UBQLN1 | chr9 | 86280060 | - | 3277 | 1015 | 43 | 1452 | 469 |
| ENST00000379561 | FOXO1 | chr13 | 41239719 | - | ENST00000257468 | UBQLN1 | chr9 | 86280060 | - | 1811 | 1015 | 43 | 1452 | 469 |
DeepORF prediction of the coding potential based on the fusion transcript sequence of in-frame fusion genes. DeepORF is a coding potential classifier based on convolutional neural network by comparing the real Ribo-seq data. If the no-coding score < 0.5 and coding score > 0.5, then the in-frame fusion transcript is predicted as being likely translated. |
| Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
| ENST00000379561 | ENST00000376395 | FOXO1 | chr13 | 41239719 | - | UBQLN1 | chr9 | 86280060 | - | 0.002854042 | 0.99714595 |
| ENST00000379561 | ENST00000257468 | FOXO1 | chr13 | 41239719 | - | UBQLN1 | chr9 | 86280060 | - | 0.03317468 | 0.96682537 |
Top |
Fusion Amino Acid Sequences |
For individual full-length fusion transcript sequence from FusionPDB, we ran ORFfinder and chose the longest ORF among the all predicted ones. |
| >FusionGDB ID_FusionGDB isoform ID_FGname_Hgene_Hchr_Hbp_Henst_Tgene_Tchr_Tbp_Tenst_length(fusion AA) seq_BP >31171_31171_1_FOXO1-UBQLN1_FOXO1_chr13_41239719_ENST00000379561_UBQLN1_chr9_86280060_ENST00000257468_length(amino acids)=469AA_BP=324 MGRASGPRRPSVLPSAALSAGARRRLCPGPAALAGRPVRAADPEEPRCGWPREVKFWARASTPPRLPPSFRPLAAPASFPQISDRPFAPP PRPPPVLRSPPLGSPAAGGGAGVTMAEAPQVVEIDPDFEPLPRPRSCTWPLPRPEFSQSNSATSSPAPSGSAAANPDAAAGLPSASAAAV SADFMSNLSLLEESEDFPQAPGSVAAAVAAAAAAAATGGLCGDFQGPEAGCLHPAPPQPPPPGPLSQHPPVPPAAAGPLAGQPRKSSSSR RNAWGNLSYADLITKAIESSAEKRLTLSQIYEWMVKSVPYFKDKGDSNSSAGWKMQNPDTLSAMSNPRAMQALLQIQQGLQTLATEAPGL IPGFTPGLGALGSTGGSSGTNGSNATPSENTSPTAGTTEPGHQQFIQQMLQALAGVNPQLQNPEVRFQQQLEQLSAMGFLNREANLQALI -------------------------------------------------------------- >31171_31171_2_FOXO1-UBQLN1_FOXO1_chr13_41239719_ENST00000379561_UBQLN1_chr9_86280060_ENST00000376395_length(amino acids)=469AA_BP=324 MGRASGPRRPSVLPSAALSAGARRRLCPGPAALAGRPVRAADPEEPRCGWPREVKFWARASTPPRLPPSFRPLAAPASFPQISDRPFAPP PRPPPVLRSPPLGSPAAGGGAGVTMAEAPQVVEIDPDFEPLPRPRSCTWPLPRPEFSQSNSATSSPAPSGSAAANPDAAAGLPSASAAAV SADFMSNLSLLEESEDFPQAPGSVAAAVAAAAAAAATGGLCGDFQGPEAGCLHPAPPQPPPPGPLSQHPPVPPAAAGPLAGQPRKSSSSR RNAWGNLSYADLITKAIESSAEKRLTLSQIYEWMVKSVPYFKDKGDSNSSAGWKMQNPDTLSAMSNPRAMQALLQIQQGLQTLATEAPGL IPGFTPGLGALGSTGGSSGTNGSNATPSENTSPTAGTTEPGHQQFIQQMLQALAGVNPQLQNPEVRFQQQLEQLSAMGFLNREANLQALI -------------------------------------------------------------- |
Top |
Fusion Protein Functional Features |
Four levels of functional features of fusion genesGo to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr13:41239719/chr9:86280060) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
![]() |
Main function of each fusion partner protein. (from UniProt) |
| Hgene | Tgene |
| FOXO1 | . |
| FUNCTION: Transcription factor that is the main target of insulin signaling and regulates metabolic homeostasis in response to oxidative stress (PubMed:10358076, PubMed:12228231, PubMed:15220471, PubMed:15890677, PubMed:18356527, PubMed:19221179, PubMed:20543840, PubMed:21245099). Binds to the insulin response element (IRE) with consensus sequence 5'-TT[G/A]TTTTG-3' and the related Daf-16 family binding element (DBE) with consensus sequence 5'-TT[G/A]TTTAC-3' (PubMed:10358076). Activity suppressed by insulin (PubMed:10358076). Main regulator of redox balance and osteoblast numbers and controls bone mass (By similarity). Orchestrates the endocrine function of the skeleton in regulating glucose metabolism (By similarity). Also acts as a key regulator of chondrogenic commitment of skeletal progenitor cells in response to lipid availability: when lipids levels are low, translocates to the nucleus and promotes expression of SOX9, which induces chondrogenic commitment and suppresses fatty acid oxidation (By similarity). Acts synergistically with ATF4 to suppress osteocalcin/BGLAP activity, increasing glucose levels and triggering glucose intolerance and insulin insensitivity (By similarity). Also suppresses the transcriptional activity of RUNX2, an upstream activator of osteocalcin/BGLAP (By similarity). In hepatocytes, promotes gluconeogenesis by acting together with PPARGC1A and CEBPA to activate the expression of genes such as IGFBP1, G6PC1 and PCK1 (By similarity). Important regulator of cell death acting downstream of CDK1, PKB/AKT1 and STK4/MST1 (PubMed:18356527, PubMed:19221179). Promotes neural cell death (PubMed:18356527). Mediates insulin action on adipose tissue (By similarity). Regulates the expression of adipogenic genes such as PPARG during preadipocyte differentiation and, adipocyte size and adipose tissue-specific gene expression in response to excessive calorie intake (By similarity). Regulates the transcriptional activity of GADD45A and repair of nitric oxide-damaged DNA in beta-cells (By similarity). Required for the autophagic cell death induction in response to starvation or oxidative stress in a transcription-independent manner (PubMed:20543840). Mediates the function of MLIP in cardiomyocytes hypertrophy and cardiac remodeling (By similarity). Regulates endothelial cell (EC) viability and apoptosis in a PPIA/CYPA-dependent manner via transcription of CCL2 and BCL2L11 which are involved in EC chemotaxis and apoptosis (PubMed:31063815). {ECO:0000250|UniProtKB:A4L7N3, ECO:0000250|UniProtKB:G3V7R4, ECO:0000250|UniProtKB:Q9R1E0, ECO:0000269|PubMed:10358076, ECO:0000269|PubMed:12228231, ECO:0000269|PubMed:15220471, ECO:0000269|PubMed:15890677, ECO:0000269|PubMed:18356527, ECO:0000269|PubMed:19221179, ECO:0000269|PubMed:20543840, ECO:0000269|PubMed:21245099, ECO:0000269|PubMed:31063815}. | FUNCTION: Might normally function as a transcriptional repressor. EWS-fusion-proteins (EFPS) may play a role in the tumorigenic process. They may disturb gene expression by mimicking, or interfering with the normal function of CTD-POLII within the transcription initiation complex. They may also contribute to an aberrant activation of the fusion protein target genes. |
Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
| - Retained protein feature among the 13 regional features. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
| Hgene | FOXO1 | chr13:41239719 | chr9:86280060 | ENST00000379561 | - | 1 | 3 | 120_130 | 210.0 | 1440.3333333333333 | Compositional bias | Note=Poly-Pro |
| Hgene | FOXO1 | chr13:41239719 | chr9:86280060 | ENST00000379561 | - | 1 | 3 | 152_155 | 210.0 | 1440.3333333333333 | Compositional bias | Note=Poly-Ser |
| Hgene | FOXO1 | chr13:41239719 | chr9:86280060 | ENST00000379561 | - | 1 | 3 | 91_102 | 210.0 | 1440.3333333333333 | Compositional bias | Note=Poly-Ala |
| Tgene | UBQLN1 | chr13:41239719 | chr9:86280060 | ENST00000257468 | 6 | 10 | 438_470 | 416.0 | 562.0 | Domain | STI1 4 | |
| Tgene | UBQLN1 | chr13:41239719 | chr9:86280060 | ENST00000257468 | 6 | 10 | 546_586 | 416.0 | 562.0 | Domain | UBA | |
| Tgene | UBQLN1 | chr13:41239719 | chr9:86280060 | ENST00000376395 | 7 | 11 | 546_586 | 444.0 | 590.0 | Domain | UBA |
| - Not-retained protein feature among the 13 regional features. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
| Hgene | FOXO1 | chr13:41239719 | chr9:86280060 | ENST00000379561 | - | 1 | 3 | 159_235 | 210.0 | 1440.3333333333333 | DNA binding | Fork-head |
| Hgene | FOXO1 | chr13:41239719 | chr9:86280060 | ENST00000379561 | - | 1 | 3 | 211_218 | 210.0 | 1440.3333333333333 | Region | Note=DNA-binding |
| Hgene | FOXO1 | chr13:41239719 | chr9:86280060 | ENST00000379561 | - | 1 | 3 | 234_237 | 210.0 | 1440.3333333333333 | Region | Note=DNA-binding |
| Tgene | UBQLN1 | chr13:41239719 | chr9:86280060 | ENST00000257468 | 6 | 10 | 182_210 | 416.0 | 562.0 | Domain | STI1 1 | |
| Tgene | UBQLN1 | chr13:41239719 | chr9:86280060 | ENST00000257468 | 6 | 10 | 212_251 | 416.0 | 562.0 | Domain | STI1 2 | |
| Tgene | UBQLN1 | chr13:41239719 | chr9:86280060 | ENST00000257468 | 6 | 10 | 37_111 | 416.0 | 562.0 | Domain | Ubiquitin-like | |
| Tgene | UBQLN1 | chr13:41239719 | chr9:86280060 | ENST00000257468 | 6 | 10 | 387_434 | 416.0 | 562.0 | Domain | STI1 3 | |
| Tgene | UBQLN1 | chr13:41239719 | chr9:86280060 | ENST00000376395 | 7 | 11 | 182_210 | 444.0 | 590.0 | Domain | STI1 1 | |
| Tgene | UBQLN1 | chr13:41239719 | chr9:86280060 | ENST00000376395 | 7 | 11 | 212_251 | 444.0 | 590.0 | Domain | STI1 2 | |
| Tgene | UBQLN1 | chr13:41239719 | chr9:86280060 | ENST00000376395 | 7 | 11 | 37_111 | 444.0 | 590.0 | Domain | Ubiquitin-like | |
| Tgene | UBQLN1 | chr13:41239719 | chr9:86280060 | ENST00000376395 | 7 | 11 | 387_434 | 444.0 | 590.0 | Domain | STI1 3 | |
| Tgene | UBQLN1 | chr13:41239719 | chr9:86280060 | ENST00000376395 | 7 | 11 | 438_470 | 444.0 | 590.0 | Domain | STI1 4 |
Top |
Fusion Protein-Protein Interaction |
Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in |
Protein-protein interactors with each fusion partner protein in wild-type from validated records (BIOGRID-3.4.160) |
| Gene | PPI interactors |
Protein-protein interactors based on sequence similarity (STRING) |
| Gene | STRING network |
| FOXO1 | ![]() |
| UBQLN1 |
- Retained interactions in fusion protein (protein functional feature from UniProt). |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
- Lost interactions due to fusion (protein functional feature from UniProt). |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
| Tgene | UBQLN1 | chr13:41239719 | chr9:86280060 | ENST00000257468 | 6 | 10 | 178_428 | 416.0 | 562.0 | UBXN4 | |
| Tgene | UBQLN1 | chr13:41239719 | chr9:86280060 | ENST00000376395 | 7 | 11 | 178_428 | 444.0 | 590.0 | UBXN4 |
Top |
Related Drugs to FOXO1-UBQLN1 |
Drugs used for this fusion-positive patient. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
| Hgene | Tgene | Drug | Source | PMID |
Top |
Related Diseases to FOXO1-UBQLN1 |
Diseases that have this fusion gene. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
| Hgene | Tgene | Disease | Source | PMID |
Diseases associated with fusion partners. (DisGeNet 4.0) |
| Partner | Gene | Disease ID | Disease name | # pubmeds | Source |
| Hgene | FOXO1 | C0020542 | Pulmonary Hypertension | 1 | CTD_human |
| Hgene | FOXO1 | C0022578 | Keratoconus | 1 | CTD_human |
| Hgene | FOXO1 | C0023467 | Leukemia, Myelocytic, Acute | 1 | CTD_human |
| Hgene | FOXO1 | C0026998 | Acute Myeloid Leukemia, M1 | 1 | CTD_human |
| Hgene | FOXO1 | C0033578 | Prostatic Neoplasms | 1 | CTD_human |
| Hgene | FOXO1 | C0206655 | Alveolar rhabdomyosarcoma | 1 | CTD_human;GENOMICS_ENGLAND;ORPHANET |
| Hgene | FOXO1 | C0376358 | Malignant neoplasm of prostate | 1 | CTD_human |
| Hgene | FOXO1 | C1879321 | Acute Myeloid Leukemia (AML-M2) | 1 | CTD_human |