| UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
|
|||||||
|
Fusion Protein:ITGA3-CASC3 |
Fusion Protein Summary |
Fusion gene summary |
| Fusion partner gene information | Fusion gene name: ITGA3-CASC3 | FusionPDB ID: 40418 | FusionGDB2.0 ID: 40418 | Hgene | Tgene | Gene symbol | ITGA3 | CASC3 | Gene ID | 3675 | 22794 |
| Gene name | integrin subunit alpha 3 | CASC3 exon junction complex subunit | |
| Synonyms | CD49C|FRP-2|GAP-B3|GAPB3|ILNEB|MSK18|VCA-2|VL3A|VLA3a | BTZ|MLN51 | |
| Cytomap | 17q21.33 | 17q21.1 | |
| Type of gene | protein-coding | protein-coding | |
| Description | integrin alpha-3CD49 antigen-like family member Calpha 3 subunit of VLA-3 receptorantigen CD49Cantigen identified by monoclonal antibody J143galactoprotein B3integrin alpha 3integrin, alpha 3 (antigen CD49C, alpha 3 subunit of VLA-3 receptor)testi | protein CASC3MLN 51barentszcancer susceptibility 3cancer susceptibility candidate 3cancer susceptibility candidate gene 3 proteinmetastatic lymph node 51metastatic lymph node gene 51 proteinprotein barentsz | |
| Modification date | 20200320 | 20200313 | |
| UniProtAcc | P26006 | O15234 | |
| Ensembl transtripts involved in fusion gene | ENST ids | ENST00000007722, ENST00000320031, ENST00000544892, | ENST00000264645, |
| Fusion gene scores for assessment (based on all fusion genes of FusionGDB 2.0) | * DoF score | 9 X 10 X 7=630 | 10 X 5 X 5=250 |
| # samples | 9 | 10 | |
| ** MAII score | log2(9/630*10)=-2.8073549220576 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | log2(10/250*10)=-1.32192809488736 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | |
| Context (manual curation of fusion genes in FusionPDB) | PubMed: ITGA3 [Title/Abstract] AND CASC3 [Title/Abstract] AND fusion [Title/Abstract] | ||
| Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) | ITGA3(48158772)-CASC3(38318006), # samples:1 | ||
| Anticipated loss of major functional domain due to fusion event. | ITGA3-CASC3 seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. ITGA3-CASC3 seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. ITGA3-CASC3 seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. ITGA3-CASC3 seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. | ||
| * DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Partner | Gene | GO ID | GO term | PubMed ID |
| Hgene | ITGA3 | GO:1903078 | positive regulation of protein localization to plasma membrane | 10455171 |
| Tgene | CASC3 | GO:0000398 | mRNA splicing, via spliceosome | 29301961 |
Fusion gene breakpoints across ITGA3 (5'-gene)* Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
![]() |
Fusion gene breakpoints across CASC3 (3'-gene)* Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
![]() |
Top |
Fusion Gene Sample Information |
Fusion gene information from FusionGDB2.0. |
Fusion gene information from two resources (ChiTars 5.0 and ChimerDB 4.0)* All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
| Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
| ChimerDB4 | BLCA | TCGA-XF-A8HH-01A | ITGA3 | chr17 | 48158772 | + | CASC3 | chr17 | 38318006 | + |
Top |
Fusion ORF Analysis |
Fusion information from ORFfinder translation from full-length transcript sequence from FusionPDB. |
| Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
| ENST00000320031 | ITGA3 | chr17 | 48158772 | + | ENST00000264645 | CASC3 | chr17 | 38318006 | + | 6842 | 3249 | 174 | 5063 | 1629 |
| ENST00000007722 | ITGA3 | chr17 | 48158772 | + | ENST00000264645 | CASC3 | chr17 | 38318006 | + | 6512 | 2919 | 0 | 4733 | 1577 |
DeepORF prediction of the coding potential based on the fusion transcript sequence of in-frame fusion genes. DeepORF is a coding potential classifier based on convolutional neural network by comparing the real Ribo-seq data. If the no-coding score < 0.5 and coding score > 0.5, then the in-frame fusion transcript is predicted as being likely translated. |
| Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
| ENST00000320031 | ENST00000264645 | ITGA3 | chr17 | 48158772 | + | CASC3 | chr17 | 38318006 | + | 0.000997052 | 0.999003 |
| ENST00000007722 | ENST00000264645 | ITGA3 | chr17 | 48158772 | + | CASC3 | chr17 | 38318006 | + | 0.000675638 | 0.99932444 |
Top |
Fusion Amino Acid Sequences |
For individual full-length fusion transcript sequence from FusionPDB, we ran ORFfinder and chose the longest ORF among the all predicted ones. |
| >FusionGDB ID_FusionGDB isoform ID_FGname_Hgene_Hchr_Hbp_Henst_Tgene_Tchr_Tbp_Tenst_length(fusion AA) seq_BP >40418_40418_1_ITGA3-CASC3_ITGA3_chr17_48158772_ENST00000007722_CASC3_chr17_38318006_ENST00000264645_length(amino acids)=1577AA_BP=973 MGPGPSRAPRAPRLMLCALALMVAAGGCVVSAFNLDTRFLVVKEAGNPGSLFGYSVALHRQTERQQRYLLLAGAPRELAVPDGYTNRTGA VYLCPLTAHKDDCERMNITVKNDPGHHIIEDMWLGVTVASQGPAGRVLVCAHRYTQVLWSGSEDQRRMVGKCYVRGNDLELDSSDDWQTY HNEMCNSNTDYLETGMCQLGTSGGFTQNTVYFGAPGAYNWKGNSYMIQRKEWDLSEYSYKDPEDQGNLYIGYTMQVGSFILHPKNITIVT GAPRHRHMGAVFLLSQEAGGDLRRRQVLEGSQVGAYFGSAIALADLNNDGWQDLLVGAPYYFERKEEVGGAIYVFMNQAGTSFPAHPSLL LHGPSGSAFGLSVASIGDINQDGFQDIAVGAPFEGLGKVYIYHSSSKGLLRQPQQVIHGEKLGLPGLATFGYSLSGQMDVDENFYPDLLV GSLSDHIVLLRARPVINIVHKTLVPRPAVLDPALCTATSCVQVELCFAYNQSAGNPNYRRNITLAYTLEADRDRRPPRLRFAGSESAVFH GFFSMPEMRCQKLELLLMDNLRDKLRPIIISMNYSLPLRMPDRPRLGLRSLDAYPILNQAQALENHTEVQFQKECGPDNKCESNLQMRAA FVSEQQQKLSRLQYSRDVRKLLLSINVTNTRTSERSGEDAHEALLTLVVPPALLLSSVRPPGACQANETIFCELGNPFKRNQRMELLIAF EVIGVTLHTRDLQVQLQLSTSSHQDNLWPMILTLLVDYTLQTSLSMVNHRLQSFFGGTVMGESGMKTVEDVGSPLKYEFQVGPMGEGLVG LGTLVLGLEWPYEVSNGKWLLYPTEITVHGNGSWPCRPPGDLINPLNLTLSDPGDRPSSPQRRRRQLDPGGGQGPPPVTLAAAKKAKSET VLTCATGRAHCVWLECPIPDAPVVTNVTVKARVWNSTFIEDYRDFDRVRVNGWATLFLRTSIPTINMENKTTWGEEGEYSEEENSKVELK SEANDAVNSSTKEEKGEEKPDTKSTVTGERQSGDGQESTEPVENKVGKKGPKHLDDDEDRKNPAYIPRKGLFFEHDLRGQTQEEEVRPKG RQRKLWKDEGRWEHDKFREDEQAPKSRQELIALYGYDIRSAHNPDDIKPRRIRKPRYGSPPQRDPNWNGERLNKSHRHQGLGGTLPPRTF INRNAAGTGRMSAPRNYSRSGGFKEGRAGFRPVEAGGQHGGRSGETVKHEISYRSRRLEQTSVRDPSPEADAPVLGSPEKEEAASEPPAA APDAAPPPPDRPIEKKSYSRARRTRTKVGDAVKLAEEVPPPPEGLIPAPPVPETTPTPPTKTGTWEAPVDSSTSGLEQDVAQLNIAEQNW SPGQPSFLQPRELRGMPNHIHMGAGPPPQFNRMEEMGVQGGRAKRYSSQRQRPVPEPPAPPVHISIMEGHYYDPLQFQGPIYTHGDSPAP LPPQGMLVQPGMNLPHPGLHPHQTPAPLPNPGLYPPPVSMSPGQPPPQQLLAPTYFSAPGVMNFGNPSYPYAPGALPPPPPPHLYPNTQA -------------------------------------------------------------- >40418_40418_2_ITGA3-CASC3_ITGA3_chr17_48158772_ENST00000320031_CASC3_chr17_38318006_ENST00000264645_length(amino acids)=1629AA_BP=1025 MGLGARNRSALRSAAAGGFQCPPAARGAGEQVLTPSSAPSRALAGTPLPLAAMGPGPSRAPRAPRLMLCALALMVAAGGCVVSAFNLDTR FLVVKEAGNPGSLFGYSVALHRQTERQQRYLLLAGAPRELAVPDGYTNRTGAVYLCPLTAHKDDCERMNITVKNDPGHHIIEDMWLGVTV ASQGPAGRVLVCAHRYTQVLWSGSEDQRRMVGKCYVRGNDLELDSSDDWQTYHNEMCNSNTDYLETGMCQLGTSGGFTQNTVYFGAPGAY NWKGNSYMIQRKEWDLSEYSYKDPEDQGNLYIGYTMQVGSFILHPKNITIVTGAPRHRHMGAVFLLSQEAGGDLRRRQVLEGSQVGAYFG SAIALADLNNDGWQDLLVGAPYYFERKEEVGGAIYVFMNQAGTSFPAHPSLLLHGPSGSAFGLSVASIGDINQDGFQDIAVGAPFEGLGK VYIYHSSSKGLLRQPQQVIHGEKLGLPGLATFGYSLSGQMDVDENFYPDLLVGSLSDHIVLLRARPVINIVHKTLVPRPAVLDPALCTAT SCVQVELCFAYNQSAGNPNYRRNITLAYTLEADRDRRPPRLRFAGSESAVFHGFFSMPEMRCQKLELLLMDNLRDKLRPIIISMNYSLPL RMPDRPRLGLRSLDAYPILNQAQALENHTEVQFQKECGPDNKCESNLQMRAAFVSEQQQKLSRLQYSRDVRKLLLSINVTNTRTSERSGE DAHEALLTLVVPPALLLSSVRPPGACQANETIFCELGNPFKRNQRMELLIAFEVIGVTLHTRDLQVQLQLSTSSHQDNLWPMILTLLVDY TLQTSLSMVNHRLQSFFGGTVMGESGMKTVEDVGSPLKYEFQVGPMGEGLVGLGTLVLGLEWPYEVSNGKWLLYPTEITVHGNGSWPCRP PGDLINPLNLTLSDPGDRPSSPQRRRRQLDPGGGQGPPPVTLAAAKKAKSETVLTCATGRAHCVWLECPIPDAPVVTNVTVKARVWNSTF IEDYRDFDRVRVNGWATLFLRTSIPTINMENKTTWGEEGEYSEEENSKVELKSEANDAVNSSTKEEKGEEKPDTKSTVTGERQSGDGQES TEPVENKVGKKGPKHLDDDEDRKNPAYIPRKGLFFEHDLRGQTQEEEVRPKGRQRKLWKDEGRWEHDKFREDEQAPKSRQELIALYGYDI RSAHNPDDIKPRRIRKPRYGSPPQRDPNWNGERLNKSHRHQGLGGTLPPRTFINRNAAGTGRMSAPRNYSRSGGFKEGRAGFRPVEAGGQ HGGRSGETVKHEISYRSRRLEQTSVRDPSPEADAPVLGSPEKEEAASEPPAAAPDAAPPPPDRPIEKKSYSRARRTRTKVGDAVKLAEEV PPPPEGLIPAPPVPETTPTPPTKTGTWEAPVDSSTSGLEQDVAQLNIAEQNWSPGQPSFLQPRELRGMPNHIHMGAGPPPQFNRMEEMGV QGGRAKRYSSQRQRPVPEPPAPPVHISIMEGHYYDPLQFQGPIYTHGDSPAPLPPQGMLVQPGMNLPHPGLHPHQTPAPLPNPGLYPPPV SMSPGQPPPQQLLAPTYFSAPGVMNFGNPSYPYAPGALPPPPPPHLYPNTQAPSQVYGGVTYYNPAQQQVQPKPSPPRRTPQPVTIKPPP -------------------------------------------------------------- |
Top |
Fusion Protein Functional Features |
Four levels of functional features of fusion genesGo to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr17:48158772/chr17:38318006) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
![]() |
Main function of each fusion partner protein. (from UniProt) |
| Hgene | Tgene |
| ITGA3 | CASC3 |
| FUNCTION: Integrin alpha-3/beta-1 is a receptor for fibronectin, laminin, collagen, epiligrin, thrombospondin and CSPG4. Integrin alpha-3/beta-1 provides a docking site for FAP (seprase) at invadopodia plasma membranes in a collagen-dependent manner and hence may participate in the adhesion, formation of invadopodia and matrix degradation processes, promoting cell invasion. Alpha-3/beta-1 may mediate with LGALS3 the stimulation by CSPG4 of endothelial cells migration. {ECO:0000269|PubMed:10455171, ECO:0000269|PubMed:15181153}. | FUNCTION: Required for pre-mRNA splicing as component of the spliceosome (PubMed:28502770, PubMed:29301961). Core component of the splicing-dependent multiprotein exon junction complex (EJC) deposited at splice junctions on mRNAs. The EJC is a dynamic structure consisting of core proteins and several peripheral nuclear and cytoplasmic associated factors that join the complex only transiently either during EJC assembly or during subsequent mRNA metabolism. The EJC marks the position of the exon-exon junction in the mature mRNA for the gene expression machinery and the core components remain bound to spliced mRNAs throughout all stages of mRNA metabolism thereby influencing downstream processes including nuclear mRNA export, subcellular mRNA localization, translation efficiency and nonsense-mediated mRNA decay (NMD). Stimulates the ATPase and RNA-helicase activities of EIF4A3. Plays a role in the stress response by participating in cytoplasmic stress granules assembly and by favoring cell recovery following stress. Component of the dendritic ribonucleoprotein particles (RNPs) in hippocampal neurons. May play a role in mRNA transport. Binds spliced mRNA in sequence-independent manner, 20-24 nucleotides upstream of mRNA exon-exon junctions. Binds poly(G) and poly(U) RNA homopolymer. {ECO:0000269|PubMed:17375189, ECO:0000269|PubMed:17652158, ECO:0000269|PubMed:28502770, ECO:0000269|PubMed:29301961}. |
Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
| - Retained protein feature among the 13 regional features. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
| Hgene | ITGA3 | chr17:48158772 | chr17:38318006 | ENST00000007722 | + | 23 | 25 | 315_323 | 973.0 | 1067.0 | Calcium binding | Ontology_term=ECO:0000255 |
| Hgene | ITGA3 | chr17:48158772 | chr17:38318006 | ENST00000007722 | + | 23 | 25 | 378_386 | 973.0 | 1067.0 | Calcium binding | Ontology_term=ECO:0000255 |
| Hgene | ITGA3 | chr17:48158772 | chr17:38318006 | ENST00000007722 | + | 23 | 25 | 439_447 | 973.0 | 1067.0 | Calcium binding | Ontology_term=ECO:0000255 |
| Hgene | ITGA3 | chr17:48158772 | chr17:38318006 | ENST00000320031 | + | 23 | 26 | 315_323 | 973.0 | 1330.3333333333333 | Calcium binding | Ontology_term=ECO:0000255 |
| Hgene | ITGA3 | chr17:48158772 | chr17:38318006 | ENST00000320031 | + | 23 | 26 | 378_386 | 973.0 | 1330.3333333333333 | Calcium binding | Ontology_term=ECO:0000255 |
| Hgene | ITGA3 | chr17:48158772 | chr17:38318006 | ENST00000320031 | + | 23 | 26 | 439_447 | 973.0 | 1330.3333333333333 | Calcium binding | Ontology_term=ECO:0000255 |
| Hgene | ITGA3 | chr17:48158772 | chr17:38318006 | ENST00000007722 | + | 23 | 25 | 110_171 | 973.0 | 1067.0 | Repeat | FG-GAP 2 |
| Hgene | ITGA3 | chr17:48158772 | chr17:38318006 | ENST00000007722 | + | 23 | 25 | 185_235 | 973.0 | 1067.0 | Repeat | FG-GAP 3 |
| Hgene | ITGA3 | chr17:48158772 | chr17:38318006 | ENST00000007722 | + | 23 | 25 | 236_292 | 973.0 | 1067.0 | Repeat | FG-GAP 4 |
| Hgene | ITGA3 | chr17:48158772 | chr17:38318006 | ENST00000007722 | + | 23 | 25 | 293_354 | 973.0 | 1067.0 | Repeat | FG-GAP 5 |
| Hgene | ITGA3 | chr17:48158772 | chr17:38318006 | ENST00000007722 | + | 23 | 25 | 356_411 | 973.0 | 1067.0 | Repeat | FG-GAP 6 |
| Hgene | ITGA3 | chr17:48158772 | chr17:38318006 | ENST00000007722 | + | 23 | 25 | 38_103 | 973.0 | 1067.0 | Repeat | FG-GAP 1 |
| Hgene | ITGA3 | chr17:48158772 | chr17:38318006 | ENST00000007722 | + | 23 | 25 | 415_477 | 973.0 | 1067.0 | Repeat | FG-GAP 7 |
| Hgene | ITGA3 | chr17:48158772 | chr17:38318006 | ENST00000320031 | + | 23 | 26 | 110_171 | 973.0 | 1330.3333333333333 | Repeat | FG-GAP 2 |
| Hgene | ITGA3 | chr17:48158772 | chr17:38318006 | ENST00000320031 | + | 23 | 26 | 185_235 | 973.0 | 1330.3333333333333 | Repeat | FG-GAP 3 |
| Hgene | ITGA3 | chr17:48158772 | chr17:38318006 | ENST00000320031 | + | 23 | 26 | 236_292 | 973.0 | 1330.3333333333333 | Repeat | FG-GAP 4 |
| Hgene | ITGA3 | chr17:48158772 | chr17:38318006 | ENST00000320031 | + | 23 | 26 | 293_354 | 973.0 | 1330.3333333333333 | Repeat | FG-GAP 5 |
| Hgene | ITGA3 | chr17:48158772 | chr17:38318006 | ENST00000320031 | + | 23 | 26 | 356_411 | 973.0 | 1330.3333333333333 | Repeat | FG-GAP 6 |
| Hgene | ITGA3 | chr17:48158772 | chr17:38318006 | ENST00000320031 | + | 23 | 26 | 38_103 | 973.0 | 1330.3333333333333 | Repeat | FG-GAP 1 |
| Hgene | ITGA3 | chr17:48158772 | chr17:38318006 | ENST00000320031 | + | 23 | 26 | 415_477 | 973.0 | 1330.3333333333333 | Repeat | FG-GAP 7 |
| Tgene | CASC3 | chr17:48158772 | chr17:38318006 | ENST00000264645 | 2 | 14 | 392_395 | 99.0 | 1130.6666666666667 | Compositional bias | Note=Poly-Pro | |
| Tgene | CASC3 | chr17:48158772 | chr17:38318006 | ENST00000264645 | 2 | 14 | 425_428 | 99.0 | 1130.6666666666667 | Compositional bias | Note=Poly-Pro | |
| Tgene | CASC3 | chr17:48158772 | chr17:38318006 | ENST00000264645 | 2 | 14 | 643_648 | 99.0 | 1130.6666666666667 | Compositional bias | Note=Poly-Pro | |
| Tgene | CASC3 | chr17:48158772 | chr17:38318006 | ENST00000264645 | 2 | 14 | 692_695 | 99.0 | 1130.6666666666667 | Compositional bias | Note=Poly-Pro | |
| Tgene | CASC3 | chr17:48158772 | chr17:38318006 | ENST00000264645 | 2 | 14 | 204_210 | 99.0 | 1130.6666666666667 | Motif | Nuclear localization signal 1 | |
| Tgene | CASC3 | chr17:48158772 | chr17:38318006 | ENST00000264645 | 2 | 14 | 254_262 | 99.0 | 1130.6666666666667 | Motif | Nuclear localization signal 2 | |
| Tgene | CASC3 | chr17:48158772 | chr17:38318006 | ENST00000264645 | 2 | 14 | 462_466 | 99.0 | 1130.6666666666667 | Motif | Note=Nuclear export signal | |
| Tgene | CASC3 | chr17:48158772 | chr17:38318006 | ENST00000264645 | 2 | 14 | 137_283 | 99.0 | 1130.6666666666667 | Region | Note=Sufficient to form the EJC | |
| Tgene | CASC3 | chr17:48158772 | chr17:38318006 | ENST00000264645 | 2 | 14 | 377_703 | 99.0 | 1130.6666666666667 | Region | Note=Necessary for localization in cytoplasmic stress granules |
| - Not-retained protein feature among the 13 regional features. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
| Hgene | ITGA3 | chr17:48158772 | chr17:38318006 | ENST00000007722 | + | 23 | 25 | 1017_1021 | 973.0 | 1067.0 | Motif | Note=GFFKR motif |
| Hgene | ITGA3 | chr17:48158772 | chr17:38318006 | ENST00000320031 | + | 23 | 26 | 1017_1021 | 973.0 | 1330.3333333333333 | Motif | Note=GFFKR motif |
| Hgene | ITGA3 | chr17:48158772 | chr17:38318006 | ENST00000007722 | + | 23 | 25 | 1015_1051 | 973.0 | 1067.0 | Topological domain | Cytoplasmic |
| Hgene | ITGA3 | chr17:48158772 | chr17:38318006 | ENST00000007722 | + | 23 | 25 | 33_991 | 973.0 | 1067.0 | Topological domain | Extracellular |
| Hgene | ITGA3 | chr17:48158772 | chr17:38318006 | ENST00000320031 | + | 23 | 26 | 1015_1051 | 973.0 | 1330.3333333333333 | Topological domain | Cytoplasmic |
| Hgene | ITGA3 | chr17:48158772 | chr17:38318006 | ENST00000320031 | + | 23 | 26 | 33_991 | 973.0 | 1330.3333333333333 | Topological domain | Extracellular |
| Hgene | ITGA3 | chr17:48158772 | chr17:38318006 | ENST00000007722 | + | 23 | 25 | 992_1014 | 973.0 | 1067.0 | Transmembrane | Helical |
| Hgene | ITGA3 | chr17:48158772 | chr17:38318006 | ENST00000320031 | + | 23 | 26 | 992_1014 | 973.0 | 1330.3333333333333 | Transmembrane | Helical |
| Tgene | CASC3 | chr17:48158772 | chr17:38318006 | ENST00000264645 | 2 | 14 | 95_131 | 99.0 | 1130.6666666666667 | Coiled coil | Ontology_term=ECO:0000255 | |
| Tgene | CASC3 | chr17:48158772 | chr17:38318006 | ENST00000264645 | 2 | 14 | 41_46 | 99.0 | 1130.6666666666667 | Compositional bias | Note=Poly-Gly |
Top |
Fusion Protein-Protein Interaction |
Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in |
Protein-protein interactors with each fusion partner protein in wild-type from validated records (BIOGRID-3.4.160) |
| Gene | PPI interactors |
Protein-protein interactors based on sequence similarity (STRING) |
| Gene | STRING network |
| ITGA3 | |
| CASC3 |
- Retained interactions in fusion protein (protein functional feature from UniProt). |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
- Lost interactions due to fusion (protein functional feature from UniProt). |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
| Hgene | ITGA3 | chr17:48158772 | chr17:38318006 | ENST00000007722 | + | 23 | 25 | 1015_1021 | 973.0 | 1067.0 | HPS5 |
| Hgene | ITGA3 | chr17:48158772 | chr17:38318006 | ENST00000320031 | + | 23 | 26 | 1015_1021 | 973.0 | 1330.3333333333333 | HPS5 |
Top |
Related Drugs to ITGA3-CASC3 |
Drugs used for this fusion-positive patient. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
| Hgene | Tgene | Drug | Source | PMID |
Top |
Related Diseases to ITGA3-CASC3 |
Diseases that have this fusion gene. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
| Hgene | Tgene | Disease | Source | PMID |
Diseases associated with fusion partners. (DisGeNet 4.0) |
| Partner | Gene | Disease ID | Disease name | # pubmeds | Source |