| UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
|
|||||||
|
Fusion Protein:MAP3K5-IFNGR1 |
Fusion Protein Summary |
Fusion gene summary |
| Fusion partner gene information | Fusion gene name: MAP3K5-IFNGR1 | FusionPDB ID: 51326 | FusionGDB2.0 ID: 51326 | Hgene | Tgene | Gene symbol | MAP3K5 | IFNGR1 | Gene ID | 4217 | 3459 |
| Gene name | mitogen-activated protein kinase kinase kinase 5 | interferon gamma receptor 1 | |
| Synonyms | ASK1|MAPKKK5|MEKK5 | CD119|IFNGR|IMD27A|IMD27B | |
| Cytomap | 6q23.3 | 6q23.3 | |
| Type of gene | protein-coding | protein-coding | |
| Description | mitogen-activated protein kinase kinase kinase 5ASK-1MAP/ERK kinase kinase 5MAPK/ERK kinase kinase 5MEK kinase 5MEKK 5apoptosis signal-regulating kinase 1 | interferon gamma receptor 1AVP, type 2CD119 antigenCDw119IFN-gamma receptor 1IFN-gamma-R-alphaIFN-gamma-R1antiviral protein, type 2immune interferon receptor 1interferon-gamma receptor alpha chain | |
| Modification date | 20200327 | 20200313 | |
| UniProtAcc | Q99683 | P15260 | |
| Ensembl transtripts involved in fusion gene | ENST ids | ENST00000359015, ENST00000355845, ENST00000463140, | ENST00000478333, ENST00000367735, ENST00000367739, ENST00000543628, |
| Fusion gene scores for assessment (based on all fusion genes of FusionGDB 2.0) | * DoF score | 14 X 11 X 10=1540 | 7 X 5 X 4=140 |
| # samples | 16 | 9 | |
| ** MAII score | log2(16/1540*10)=-3.2667865406949 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | log2(9/140*10)=-0.637429920615292 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | |
| Context (manual curation of fusion genes in FusionPDB) | PubMed: MAP3K5 [Title/Abstract] AND IFNGR1 [Title/Abstract] AND fusion [Title/Abstract] | ||
| Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) | MAP3K5(137041587)-IFNGR1(137524822), # samples:1 MAP3K5(137112847)-IFNGR1(137528214), # samples:1 MAP3K5(137112848)-IFNGR1(137528214), # samples:1 | ||
| Anticipated loss of major functional domain due to fusion event. | MAP3K5-IFNGR1 seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. MAP3K5-IFNGR1 seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. MAP3K5-IFNGR1 seems lost the major protein functional domain in Hgene partner, which is a essential gene due to the frame-shifted ORF. MAP3K5-IFNGR1 seems lost the major protein functional domain in Hgene partner, which is a IUPHAR drug target due to the frame-shifted ORF. MAP3K5-IFNGR1 seems lost the major protein functional domain in Hgene partner, which is a kinase due to the frame-shifted ORF. MAP3K5-IFNGR1 seems lost the major protein functional domain in Tgene partner, which is a IUPHAR drug target due to the frame-shifted ORF. | ||
| * DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Partner | Gene | GO ID | GO term | PubMed ID |
| Hgene | MAP3K5 | GO:0000165 | MAPK cascade | 17210579|21771788 |
| Hgene | MAP3K5 | GO:0000186 | activation of MAPKK activity | 11959862 |
| Hgene | MAP3K5 | GO:0006468 | protein phosphorylation | 11096076|15983381 |
| Hgene | MAP3K5 | GO:0007254 | JNK cascade | 21771788 |
| Hgene | MAP3K5 | GO:0008631 | intrinsic apoptotic signaling pathway in response to oxidative stress | 21771788 |
| Hgene | MAP3K5 | GO:0034198 | cellular response to amino acid starvation | 11096076 |
| Hgene | MAP3K5 | GO:0043065 | positive regulation of apoptotic process | 21771788 |
| Hgene | MAP3K5 | GO:0043280 | positive regulation of cysteine-type endopeptidase activity involved in apoptotic process | 20674765 |
| Hgene | MAP3K5 | GO:0045893 | positive regulation of transcription, DNA-templated | 11096076 |
| Hgene | MAP3K5 | GO:0051403 | stress-activated MAPK cascade | 11096076 |
| Hgene | MAP3K5 | GO:0070301 | cellular response to hydrogen peroxide | 20674765 |
Fusion gene breakpoints across MAP3K5 (5'-gene)* Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Fusion gene breakpoints across IFNGR1 (3'-gene)* Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Top |
Fusion Gene Sample Information |
Fusion gene information from FusionGDB2.0. |
Fusion gene information from two resources (ChiTars 5.0 and ChimerDB 4.0)* All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
| Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
| ChimerDB4 | ESCA | TCGA-L5-A4OS | MAP3K5 | chr6 | 137041587 | - | IFNGR1 | chr6 | 137524822 | - |
| ChimerDB4 | STAD | TCGA-VQ-A922-01A | MAP3K5 | chr6 | 137112848 | - | IFNGR1 | chr6 | 137528214 | - |
| ChimerDB4 | STAD | TCGA-VQ-A922 | MAP3K5 | chr6 | 137112847 | - | IFNGR1 | chr6 | 137528214 | - |
Top |
Fusion ORF Analysis |
Fusion information from ORFfinder translation from full-length transcript sequence from FusionPDB. |
| Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
| ENST00000359015 | MAP3K5 | chr6 | 137041587 | - | ENST00000367739 | IFNGR1 | chr6 | 137524822 | - | 2420 | 949 | 124 | 1872 | 582 |
| ENST00000359015 | MAP3K5 | chr6 | 137041587 | - | ENST00000543628 | IFNGR1 | chr6 | 137524822 | - | 2072 | 949 | 124 | 1872 | 582 |
DeepORF prediction of the coding potential based on the fusion transcript sequence of in-frame fusion genes. DeepORF is a coding potential classifier based on convolutional neural network by comparing the real Ribo-seq data. If the no-coding score < 0.5 and coding score > 0.5, then the in-frame fusion transcript is predicted as being likely translated. |
| Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
| ENST00000359015 | ENST00000367739 | MAP3K5 | chr6 | 137041587 | - | IFNGR1 | chr6 | 137524822 | - | 0.000645558 | 0.9993544 |
| ENST00000359015 | ENST00000543628 | MAP3K5 | chr6 | 137041587 | - | IFNGR1 | chr6 | 137524822 | - | 0.001374875 | 0.99862516 |
Top |
Fusion Amino Acid Sequences |
For individual full-length fusion transcript sequence from FusionPDB, we ran ORFfinder and chose the longest ORF among the all predicted ones. |
| >FusionGDB ID_FusionGDB isoform ID_FGname_Hgene_Hchr_Hbp_Henst_Tgene_Tchr_Tbp_Tenst_length(fusion AA) seq_BP >51326_51326_1_MAP3K5-IFNGR1_MAP3K5_chr6_137041587_ENST00000359015_IFNGR1_chr6_137524822_ENST00000367739_length(amino acids)=582AA_BP=275 MQRASGAATEAPRRSEPPPGSGVPSGERAPERRRRRGGEGAARDGSCLARRARSSPELWLARRCGWAGDAAAVAARPGEMSTEADEGITF SVPPFAPSGFCTIPEGGICRRGGAAAVGEGEEHQLPPPPPGSFWNVESAAAPGIGCPAATSSSSATRGRGSSVGGGSRRTTVAYVINEAS QGQLVVAESEALQSLREACETVGATLETLHFGKLDFGETTVLDRFYNADIAVVEMSDAFRQPSLFYHLGVRESFSMANNIILYCDTNSDS LQSLKIQYKILTQKEDDCDEIQCQLAIPVSSLNSQYCVSAEGVLHVWGVTTEKSKEVCITIFNSSIKGSLWIPVVAALLLFLVLSLVFIC FYIKKINPLKEKSIILPKSLISVVRSATLETKPESKYVSLITSYQPFSLEKEVVCEEPLSPATVPGMHTEDNPGKVEHTEELSSITEVVT TEENIPDVVPGSHLTPIERESSSPLSSNQSEPGSIALNSYHSRNCSESDHSRNGFDTDSSCLESHSSLSDSEFPPNNKGEIKTEGQELIT -------------------------------------------------------------- >51326_51326_2_MAP3K5-IFNGR1_MAP3K5_chr6_137041587_ENST00000359015_IFNGR1_chr6_137524822_ENST00000543628_length(amino acids)=582AA_BP=275 MQRASGAATEAPRRSEPPPGSGVPSGERAPERRRRRGGEGAARDGSCLARRARSSPELWLARRCGWAGDAAAVAARPGEMSTEADEGITF SVPPFAPSGFCTIPEGGICRRGGAAAVGEGEEHQLPPPPPGSFWNVESAAAPGIGCPAATSSSSATRGRGSSVGGGSRRTTVAYVINEAS QGQLVVAESEALQSLREACETVGATLETLHFGKLDFGETTVLDRFYNADIAVVEMSDAFRQPSLFYHLGVRESFSMANNIILYCDTNSDS LQSLKIQYKILTQKEDDCDEIQCQLAIPVSSLNSQYCVSAEGVLHVWGVTTEKSKEVCITIFNSSIKGSLWIPVVAALLLFLVLSLVFIC FYIKKINPLKEKSIILPKSLISVVRSATLETKPESKYVSLITSYQPFSLEKEVVCEEPLSPATVPGMHTEDNPGKVEHTEELSSITEVVT TEENIPDVVPGSHLTPIERESSSPLSSNQSEPGSIALNSYHSRNCSESDHSRNGFDTDSSCLESHSSLSDSEFPPNNKGEIKTEGQELIT -------------------------------------------------------------- |
Top |
Fusion Protein Functional Features |
Four levels of functional features of fusion genesGo to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr6:137041587/chr6:137524822) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
![]() |
Main function of each fusion partner protein. (from UniProt) |
| Hgene | Tgene |
| MAP3K5 | IFNGR1 |
| FUNCTION: Serine/threonine kinase which acts as an essential component of the MAP kinase signal transduction pathway. Plays an important role in the cascades of cellular responses evoked by changes in the environment. Mediates signaling for determination of cell fate such as differentiation and survival. Plays a crucial role in the apoptosis signal transduction pathway through mitochondria-dependent caspase activation. MAP3K5/ASK1 is required for the innate immune response, which is essential for host defense against a wide range of pathogens. Mediates signal transduction of various stressors like oxidative stress as well as by receptor-mediated inflammatory signals, such as the tumor necrosis factor (TNF) or lipopolysaccharide (LPS). Once activated, acts as an upstream activator of the MKK/JNK signal transduction cascade and the p38 MAPK signal transduction cascade through the phosphorylation and activation of several MAP kinase kinases like MAP2K4/SEK1, MAP2K3/MKK3, MAP2K6/MKK6 and MAP2K7/MKK7. These MAP2Ks in turn activate p38 MAPKs and c-jun N-terminal kinases (JNKs). Both p38 MAPK and JNKs control the transcription factors activator protein-1 (AP-1). {ECO:0000269|PubMed:10411906, ECO:0000269|PubMed:10688666, ECO:0000269|PubMed:10849426, ECO:0000269|PubMed:11029458, ECO:0000269|PubMed:11154276, ECO:0000269|PubMed:11689443, ECO:0000269|PubMed:11920685, ECO:0000269|PubMed:12697749, ECO:0000269|PubMed:14688258, ECO:0000269|PubMed:14749717, ECO:0000269|PubMed:15023544, ECO:0000269|PubMed:16129676, ECO:0000269|PubMed:17220297, ECO:0000269|PubMed:23102700, ECO:0000269|PubMed:26095851, ECO:0000269|PubMed:8940179, ECO:0000269|PubMed:8974401, ECO:0000269|PubMed:9564042, ECO:0000269|PubMed:9774977}. | FUNCTION: Associates with IFNGR2 to form a receptor for the cytokine interferon gamma (IFNG) (PubMed:7615558, PubMed:2971451, PubMed:7617032, PubMed:10986460). Ligand binding stimulates activation of the JAK/STAT signaling pathway (PubMed:7673114). Plays an essential role in the IFN-gamma pathway that is required for the cellular response to infectious agents (PubMed:20015550). {ECO:0000269|PubMed:10986460, ECO:0000269|PubMed:20015550, ECO:0000269|PubMed:2971451, ECO:0000269|PubMed:7615558, ECO:0000269|PubMed:7617032, ECO:0000269|PubMed:7673114}. |
Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
| - Retained protein feature among the 13 regional features. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
| Tgene | IFNGR1 | chr6:137041587 | chr6:137524822 | ENST00000367739 | 3 | 7 | 267_489 | 182.0 | 490.0 | Topological domain | Cytoplasmic | |
| Tgene | IFNGR1 | chr6:137041587 | chr6:137524822 | ENST00000367739 | 3 | 7 | 246_266 | 182.0 | 490.0 | Transmembrane | Helical |
| - Not-retained protein feature among the 13 regional features. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
| Hgene | MAP3K5 | chr6:137041587 | chr6:137524822 | ENST00000359015 | - | 2 | 30 | 1245_1285 | 196.0 | 1375.0 | Coiled coil | Ontology_term=ECO:0000255 |
| Hgene | MAP3K5 | chr6:137041587 | chr6:137524822 | ENST00000359015 | - | 2 | 30 | 680_938 | 196.0 | 1375.0 | Domain | Protein kinase |
| Hgene | MAP3K5 | chr6:137041587 | chr6:137524822 | ENST00000359015 | - | 2 | 30 | 686_694 | 196.0 | 1375.0 | Nucleotide binding | ATP |
| Tgene | IFNGR1 | chr6:137041587 | chr6:137524822 | ENST00000367739 | 3 | 7 | 18_245 | 182.0 | 490.0 | Topological domain | Extracellular |
Top |
Fusion Protein-Protein Interaction |
Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in |
Protein-protein interactors with each fusion partner protein in wild-type from validated records (BIOGRID-3.4.160) |
| Gene | PPI interactors |
Protein-protein interactors based on sequence similarity (STRING) |
| Gene | STRING network |
| MAP3K5 | |
| IFNGR1 |
- Retained interactions in fusion protein (protein functional feature from UniProt). |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
- Lost interactions due to fusion (protein functional feature from UniProt). |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
| Hgene | MAP3K5 | chr6:137041587 | chr6:137524822 | ENST00000359015 | - | 2 | 30 | 649_1374 | 196.0 | 1375.0 | PPIA/CYPA |
Top |
Related Drugs to MAP3K5-IFNGR1 |
Drugs used for this fusion-positive patient. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
| Hgene | Tgene | Drug | Source | PMID |
Top |
Related Diseases to MAP3K5-IFNGR1 |
Diseases that have this fusion gene. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
| Hgene | Tgene | Disease | Source | PMID |
Diseases associated with fusion partners. (DisGeNet 4.0) |
| Partner | Gene | Disease ID | Disease name | # pubmeds | Source |