| UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
|
|||||||
|
Fusion Protein:ABR-NXN |
Fusion Protein Summary |
Fusion gene summary |
| Fusion partner gene information | Fusion gene name: ABR-NXN | FusionPDB ID: 556 | FusionGDB2.0 ID: 556 | Hgene | Tgene | Gene symbol | ABR | NXN | Gene ID | 29 | 64359 |
| Gene name | ABR activator of RhoGEF and GTPase | nucleoredoxin | |
| Synonyms | MDB | NRX|RRS2|TRG-4 | |
| Cytomap | 17p13.3 | 17p13.3 | |
| Type of gene | protein-coding | protein-coding | |
| Description | active breakpoint cluster region-related proteinABR, RhoGEF and GTPase activating proteinactive BCR-related | nucleoredoxinnucleoredoxin 1 | |
| Modification date | 20200313 | 20200327 | |
| UniProtAcc | Q15018 | . | |
| Ensembl transtripts involved in fusion gene | ENST ids | ENST00000291107, ENST00000302538, ENST00000536794, ENST00000544583, ENST00000574437, ENST00000543210, ENST00000572441, ENST00000573895, | ENST00000537628, ENST00000575801, ENST00000577098, ENST00000538650, ENST00000336868, |
| Fusion gene scores for assessment (based on all fusion genes of FusionGDB 2.0) | * DoF score | 23 X 15 X 14=4830 | 17 X 15 X 5=1275 |
| # samples | 36 | 20 | |
| ** MAII score | log2(36/4830*10)=-3.74595437739346 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | log2(20/1275*10)=-2.6724253419715 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | |
| Context (manual curation of fusion genes in FusionPDB) | PubMed: ABR [Title/Abstract] AND NXN [Title/Abstract] AND fusion [Title/Abstract] | ||
| Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) | NXN(882559)-ABR(916404), # samples:5 ABR(953290)-NXN(729318), # samples:2 | ||
| Anticipated loss of major functional domain due to fusion event. | ABR-NXN seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. ABR-NXN seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. ABR-NXN seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. ABR-NXN seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. NXN-ABR seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. NXN-ABR seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. ABR-NXN seems lost the major protein functional domain in Hgene partner, which is a kinase due to the frame-shifted ORF. ABR-NXN seems lost the major protein functional domain in Tgene partner, which is a essential gene due to the frame-shifted ORF. | ||
| * DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Partner | Gene | GO ID | GO term | PubMed ID |
| Hgene | ABR | GO:0090630 | activation of GTPase activity | 7479768 |
Fusion gene breakpoints across ABR (5'-gene)* Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
![]() |
Fusion gene breakpoints across NXN (3'-gene)* Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
![]() |
Top |
Fusion Gene Sample Information |
Fusion gene information from FusionGDB2.0. |
Fusion gene information from two resources (ChiTars 5.0 and ChimerDB 4.0)* All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
| Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
| ChimerDB4 | BRCA | TCGA-OL-A66P-01A | ABR | chr17 | 953290 | - | NXN | chr17 | 729318 | - |
| ChimerDB4 | LUAD | TCGA-91-6836-01A | ABR | chr17 | 1082961 | - | NXN | chr17 | 729318 | - |
| ChimerDB4 | SKCM | TCGA-D3-A3CC-06A | ABR | chr17 | 953290 | - | NXN | chr17 | 729318 | - |
Top |
Fusion ORF Analysis |
Fusion information from ORFfinder translation from full-length transcript sequence from FusionPDB. |
| Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
| ENST00000302538 | ABR | chr17 | 953290 | - | ENST00000336868 | NXN | chr17 | 729318 | - | 4522 | 1938 | 147 | 2885 | 912 |
| ENST00000574437 | ABR | chr17 | 953290 | - | ENST00000336868 | NXN | chr17 | 729318 | - | 4702 | 2118 | 123 | 3065 | 980 |
| ENST00000291107 | ABR | chr17 | 953290 | - | ENST00000336868 | NXN | chr17 | 729318 | - | 4296 | 1712 | 32 | 2659 | 875 |
| ENST00000536794 | ABR | chr17 | 953290 | - | ENST00000336868 | NXN | chr17 | 729318 | - | 4008 | 1424 | 140 | 2371 | 743 |
| ENST00000302538 | ABR | chr17 | 1082961 | - | ENST00000336868 | NXN | chr17 | 729318 | - | 2792 | 208 | 298 | 1155 | 285 |
DeepORF prediction of the coding potential based on the fusion transcript sequence of in-frame fusion genes. DeepORF is a coding potential classifier based on convolutional neural network by comparing the real Ribo-seq data. If the no-coding score < 0.5 and coding score > 0.5, then the in-frame fusion transcript is predicted as being likely translated. |
| Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
| ENST00000302538 | ENST00000336868 | ABR | chr17 | 953290 | - | NXN | chr17 | 729318 | - | 0.00139378 | 0.99860626 |
| ENST00000574437 | ENST00000336868 | ABR | chr17 | 953290 | - | NXN | chr17 | 729318 | - | 0.002188315 | 0.99781173 |
| ENST00000291107 | ENST00000336868 | ABR | chr17 | 953290 | - | NXN | chr17 | 729318 | - | 0.002950157 | 0.9970498 |
| ENST00000536794 | ENST00000336868 | ABR | chr17 | 953290 | - | NXN | chr17 | 729318 | - | 0.010014015 | 0.989986 |
| ENST00000302538 | ENST00000336868 | ABR | chr17 | 1082961 | - | NXN | chr17 | 729318 | - | 0.002810958 | 0.9971891 |
Top |
Fusion Amino Acid Sequences |
For individual full-length fusion transcript sequence from FusionPDB, we ran ORFfinder and chose the longest ORF among the all predicted ones. |
| >FusionGDB ID_FusionGDB isoform ID_FGname_Hgene_Hchr_Hbp_Henst_Tgene_Tchr_Tbp_Tenst_length(fusion AA) seq_BP >556_556_1_ABR-NXN_ABR_chr17_1082961_ENST00000302538_NXN_chr17_729318_ENST00000336868_length(amino acids)=285AA_BP= MLVIRDDPEGLEFPWGPKPFREVIAGPLLRNNGQSLESSSLEGSHVGVYFSAHWCPPCRSLTRVLVESYRKIKEAGQNFEIIFVSADRSE ESFKQYFSEMPWLAVPYTDEARRSRLNRLYGIQGIPTLIMLDPQGEVITRQGRVEVLNDEDCREFPWHPKPVLELSDSNAAQLNEGPCLV LFVDSEDDGESEAAKQLIQPIAEKIIAKYKAKEEEAPLLFFVAGEDDMTDSLRDYTNLPEAAPLLTILDMSARAKYVMDVEEITPAIVEA -------------------------------------------------------------- >556_556_2_ABR-NXN_ABR_chr17_953290_ENST00000291107_NXN_chr17_729318_ENST00000336868_length(amino acids)=875AA_BP=0 MEEEEEAIGLLDKVLEDEDVFLLEECELGTPTSPGSGSPFLVAVKVEAGKGLEMRKLVLSGFLASEEIYINQLEALLLPMKPLKATATTS QPVLTIQQIETIFYKIQDIYEIHKEFYDNLCPKVQQWDSQVTMGHLFQKLASQLGVYKAFVDNYKVALETAEKCSQSNNQFQKISEELKV KGPKDSKDSHTSVTMEALLYKPIDRVTRSTLVLHDLLKHTPVDHPDYPLLQDALRISQNFLSSINEDIDPRRTAVTTPKGETRQLVKDGF LVEVSESSRKLRHVFLFTDVLLCAKLKKTSAGKHQQYDCKWYIPLADLVFPSPEESEASPQVHPFPDHELEDMKMKISALKSEIQKEKAN KGQSRAIERLKKKMFENEFLLLLNSPTIPFRIHNRNGKSYLFLLSSDYERSEWREAIQKLQKKDLQAFVLSSVELQVLTGSCFKLRTVHN IPVTSNKDDDESPGLYGFLHVIVHSAKGFKQSANLYCTLEVDSFGYFVSKAKTRVFRDTAEPKWDEEFEIELEGSQSLRILCYEKCYDKT KVNKDNNEIVDKIMGKGQIQLKLWNKYRISNIPSLIFLDATTGKVVCRNGLLVIRDDPEGLEFPWGPKPFREVIAGPLLRNNGQSLESSS LEGSHVGVYFSAHWCPPCRSLTRVLVESYRKIKEAGQNFEIIFVSADRSEESFKQYFSEMPWLAVPYTDEARRSRLNRLYGIQGIPTLIM LDPQGEVITRQGRVEVLNDEDCREFPWHPKPVLELSDSNAAQLNEGPCLVLFVDSEDDGESEAAKQLIQPIAEKIIAKYKAKEEEAPLLF -------------------------------------------------------------- >556_556_3_ABR-NXN_ABR_chr17_953290_ENST00000302538_NXN_chr17_729318_ENST00000336868_length(amino acids)=912AA_BP=0 MEPLSHRGLPRLSWIDTLYSNFSYGTDEYDGEGNEEQKGPPEGSETMPYIDESPTMSPQLSARSQGGGDGVSPTPPEGLAPGVEAGKGLE MRKLVLSGFLASEEIYINQLEALLLPMKPLKATATTSQPVLTIQQIETIFYKIQDIYEIHKEFYDNLCPKVQQWDSQVTMGHLFQKLASQ LGVYKAFVDNYKVALETAEKCSQSNNQFQKISEELKVKGPKDSKDSHTSVTMEALLYKPIDRVTRSTLVLHDLLKHTPVDHPDYPLLQDA LRISQNFLSSINEDIDPRRTAVTTPKGETRQLVKDGFLVEVSESSRKLRHVFLFTDVLLCAKLKKTSAGKHQQYDCKWYIPLADLVFPSP EESEASPQVHPFPDHELEDMKMKISALKSEIQKEKANKGQSRAIERLKKKMFENEFLLLLNSPTIPFRIHNRNGKSYLFLLSSDYERSEW REAIQKLQKKDLQAFVLSSVELQVLTGSCFKLRTVHNIPVTSNKDDDESPGLYGFLHVIVHSAKGFKQSANLYCTLEVDSFGYFVSKAKT RVFRDTAEPKWDEEFEIELEGSQSLRILCYEKCYDKTKVNKDNNEIVDKIMGKGQIQLKLWNKYRISNIPSLIFLDATTGKVVCRNGLLV IRDDPEGLEFPWGPKPFREVIAGPLLRNNGQSLESSSLEGSHVGVYFSAHWCPPCRSLTRVLVESYRKIKEAGQNFEIIFVSADRSEESF KQYFSEMPWLAVPYTDEARRSRLNRLYGIQGIPTLIMLDPQGEVITRQGRVEVLNDEDCREFPWHPKPVLELSDSNAAQLNEGPCLVLFV DSEDDGESEAAKQLIQPIAEKIIAKYKAKEEEAPLLFFVAGEDDMTDSLRDYTNLPEAAPLLTILDMSARAKYVMDVEEITPAIVEAFVN -------------------------------------------------------------- >556_556_4_ABR-NXN_ABR_chr17_953290_ENST00000536794_NXN_chr17_729318_ENST00000336868_length(amino acids)=743AA_BP=1 MLEEHSGAAARCWSPCGSISKVAEWPGCWWAPGSLERWLHAPAAGTEAAMEILLIIRFCCNCTYALLYKPIDRVTRSTLVLHDLLKHTPV DHPDYPLLQDALRISQNFLSSINEDIDPRRTAVTTPKGETRQLVKDGFLVEVSESSRKLRHVFLFTDVLLCAKLKKTSAGKHQQYDCKWY IPLADLVFPSPEESEASPQVHPFPDHELEDMKMKISALKSEIQKEKANKGQSRAIERLKKKMFENEFLLLLNSPTIPFRIHNRNGKSYLF LLSSDYERSEWREAIQKLQKKDLQAFVLSSVELQVLTGSCFKLRTVHNIPVTSNKDDDESPGLYGFLHVIVHSAKGFKQSANLYCTLEVD SFGYFVSKAKTRVFRDTAEPKWDEEFEIELEGSQSLRILCYEKCYDKTKVNKDNNEIVDKIMGKGQIQLKLWNKYRISNIPSLIFLDATT GKVVCRNGLLVIRDDPEGLEFPWGPKPFREVIAGPLLRNNGQSLESSSLEGSHVGVYFSAHWCPPCRSLTRVLVESYRKIKEAGQNFEII FVSADRSEESFKQYFSEMPWLAVPYTDEARRSRLNRLYGIQGIPTLIMLDPQGEVITRQGRVEVLNDEDCREFPWHPKPVLELSDSNAAQ LNEGPCLVLFVDSEDDGESEAAKQLIQPIAEKIIAKYKAKEEEAPLLFFVAGEDDMTDSLRDYTNLPEAAPLLTILDMSARAKYVMDVEE -------------------------------------------------------------- >556_556_5_ABR-NXN_ABR_chr17_953290_ENST00000574437_NXN_chr17_729318_ENST00000336868_length(amino acids)=980AA_BP=1 MTCSSSGSNSRAAPPRLPAAPERAGPGACWLSPAPHQAQAPAQPPPGPGVDGAAGAMAAGGRRRRPLRYQSLAALVEDSQWPFLFLVSDF SYGTDEYDGEGNEEQKGPPEGSETMPYIDESPTMSPQLSARSQGGGDGVSPTPPEGLAPGVEAGKGLEMRKLVLSGFLASEEIYINQLEA LLLPMKPLKATATTSQPVLTIQQIETIFYKIQDIYEIHKEFYDNLCPKVQQWDSQVTMGHLFQKLASQLGVYKAFVDNYKVALETAEKCS QSNNQFQKISEELKVKGPKDSKDSHTSVTMEALLYKPIDRVTRSTLVLHDLLKHTPVDHPDYPLLQDALRISQNFLSSINEDIDPRRTAV TTPKGETRQLVKDGFLVEVSESSRKLRHVFLFTDVLLCAKLKKTSAGKHQQYDCKWYIPLADLVFPSPEESEASPQVHPFPDHELEDMKM KISALKSEIQKEKANKGQSRAIERLKKKMFENEFLLLLNSPTIPFRIHNRNGKSYLFLLSSDYERSEWREAIQKLQKKDLQAFVLSSVEL QVLTGSCFKLRTVHNIPVTSNKDDDESPGLYGFLHVIVHSAKGFKQSANLYCTLEVDSFGYFVSKAKTRVFRDTAEPKWDEEFEIELEGS QSLRILCYEKCYDKTKVNKDNNEIVDKIMGKGQIQLKLWNKYRISNIPSLIFLDATTGKVVCRNGLLVIRDDPEGLEFPWGPKPFREVIA GPLLRNNGQSLESSSLEGSHVGVYFSAHWCPPCRSLTRVLVESYRKIKEAGQNFEIIFVSADRSEESFKQYFSEMPWLAVPYTDEARRSR LNRLYGIQGIPTLIMLDPQGEVITRQGRVEVLNDEDCREFPWHPKPVLELSDSNAAQLNEGPCLVLFVDSEDDGESEAAKQLIQPIAEKI -------------------------------------------------------------- |
Top |
Fusion Protein Functional Features |
Four levels of functional features of fusion genesGo to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr17:882559/chr17:916404) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
![]() |
Main function of each fusion partner protein. (from UniProt) |
| Hgene | Tgene |
| ABR | . |
| FUNCTION: Component of the BRISC complex, a multiprotein complex that specifically cleaves 'Lys-63'-linked polyubiquitin, leaving the last ubiquitin chain attached to its substrates (PubMed:19214193, PubMed:20032457, PubMed:20656690, PubMed:24075985). May act as a central scaffold protein that assembles the various components of the BRISC complex and retains them in the cytoplasm (PubMed:20656690). Plays a role in regulating the onset of apoptosis via its role in modulating 'Lys-63'-linked ubiquitination of target proteins (By similarity). Required for normal mitotic spindle assembly and microtubule attachment to kinetochores via its role in deubiquitinating NUMA1 (PubMed:26195665). Plays a role in interferon signaling via its role in the deubiquitination of the interferon receptor IFNAR1; deubiquitination increases IFNAR1 activities by enhancing its stability and cell surface expression (PubMed:24075985, PubMed:26344097). Down-regulates the response to bacterial lipopolysaccharide (LPS) via its role in IFNAR1 deubiquitination (PubMed:24075985). Required for normal induction of p53/TP53 in response to DNA damage (PubMed:25283148). Independent of the BRISC complex, promotes interaction between USP7 and p53/TP53, and thereby promotes deubiquitination of p53/TP53, preventing its degradation and resulting in increased p53/TP53-mediated transcription regulation and p53/TP53-dependent apoptosis in response to DNA damage (PubMed:25283148). {ECO:0000250|UniProtKB:Q3TCJ1, ECO:0000269|PubMed:19214193, ECO:0000269|PubMed:20032457, ECO:0000269|PubMed:20656690, ECO:0000269|PubMed:24075985, ECO:0000269|PubMed:25283148}. | FUNCTION: Might normally function as a transcriptional repressor. EWS-fusion-proteins (EFPS) may play a role in the tumorigenic process. They may disturb gene expression by mimicking, or interfering with the normal function of CTD-POLII within the transcription initiation complex. They may also contribute to an aberrant activation of the fusion protein target genes. |
Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
| - Retained protein feature among the 13 regional features. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
| Hgene | ABR | chr17:953290 | chr17:729318 | ENST00000291107 | - | 15 | 22 | 417_420 | 560.0 | 823.0 | Compositional bias | Note=Poly-Leu |
| Hgene | ABR | chr17:953290 | chr17:729318 | ENST00000302538 | - | 16 | 23 | 417_420 | 597.0 | 860.0 | Compositional bias | Note=Poly-Leu |
| Hgene | ABR | chr17:953290 | chr17:729318 | ENST00000544583 | - | 16 | 23 | 417_420 | 551.0 | 814.0 | Compositional bias | Note=Poly-Leu |
| Hgene | ABR | chr17:953290 | chr17:729318 | ENST00000574437 | - | 15 | 22 | 417_420 | 551.0 | 814.0 | Compositional bias | Note=Poly-Leu |
| Hgene | ABR | chr17:953290 | chr17:729318 | ENST00000291107 | - | 15 | 22 | 301_459 | 560.0 | 823.0 | Domain | PH |
| Hgene | ABR | chr17:953290 | chr17:729318 | ENST00000291107 | - | 15 | 22 | 91_284 | 560.0 | 823.0 | Domain | DH |
| Hgene | ABR | chr17:953290 | chr17:729318 | ENST00000302538 | - | 16 | 23 | 301_459 | 597.0 | 860.0 | Domain | PH |
| Hgene | ABR | chr17:953290 | chr17:729318 | ENST00000302538 | - | 16 | 23 | 91_284 | 597.0 | 860.0 | Domain | DH |
| Hgene | ABR | chr17:953290 | chr17:729318 | ENST00000544583 | - | 16 | 23 | 301_459 | 551.0 | 814.0 | Domain | PH |
| Hgene | ABR | chr17:953290 | chr17:729318 | ENST00000544583 | - | 16 | 23 | 91_284 | 551.0 | 814.0 | Domain | DH |
| Hgene | ABR | chr17:953290 | chr17:729318 | ENST00000574437 | - | 15 | 22 | 301_459 | 551.0 | 814.0 | Domain | PH |
| Hgene | ABR | chr17:953290 | chr17:729318 | ENST00000574437 | - | 15 | 22 | 91_284 | 551.0 | 814.0 | Domain | DH |
| Tgene | NXN | chr17:1082961 | chr17:729318 | ENST00000336868 | 0 | 8 | 167_321 | 120.0 | 436.0 | Domain | Thioredoxin | |
| Tgene | NXN | chr17:1082961 | chr17:729318 | ENST00000537628 | 0 | 8 | 167_321 | 0 | 187.0 | Domain | Thioredoxin | |
| Tgene | NXN | chr17:1082961 | chr17:729318 | ENST00000575801 | 0 | 8 | 167_321 | 12.0 | 328.0 | Domain | Thioredoxin | |
| Tgene | NXN | chr17:953290 | chr17:729318 | ENST00000336868 | 0 | 8 | 167_321 | 120.0 | 436.0 | Domain | Thioredoxin | |
| Tgene | NXN | chr17:953290 | chr17:729318 | ENST00000537628 | 0 | 8 | 167_321 | 0 | 187.0 | Domain | Thioredoxin | |
| Tgene | NXN | chr17:953290 | chr17:729318 | ENST00000575801 | 0 | 8 | 167_321 | 12.0 | 328.0 | Domain | Thioredoxin |
| - Not-retained protein feature among the 13 regional features. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
| Hgene | ABR | chr17:1082961 | chr17:729318 | ENST00000291107 | - | 1 | 22 | 417_420 | 0 | 823.0 | Compositional bias | Note=Poly-Leu |
| Hgene | ABR | chr17:1082961 | chr17:729318 | ENST00000302538 | - | 1 | 23 | 417_420 | 20.333333333333332 | 860.0 | Compositional bias | Note=Poly-Leu |
| Hgene | ABR | chr17:1082961 | chr17:729318 | ENST00000543210 | - | 1 | 8 | 417_420 | 0 | 311.0 | Compositional bias | Note=Poly-Leu |
| Hgene | ABR | chr17:1082961 | chr17:729318 | ENST00000544583 | - | 1 | 23 | 417_420 | 0 | 814.0 | Compositional bias | Note=Poly-Leu |
| Hgene | ABR | chr17:1082961 | chr17:729318 | ENST00000574437 | - | 1 | 22 | 417_420 | 0 | 814.0 | Compositional bias | Note=Poly-Leu |
| Hgene | ABR | chr17:953290 | chr17:729318 | ENST00000543210 | - | 1 | 8 | 417_420 | 0 | 311.0 | Compositional bias | Note=Poly-Leu |
| Hgene | ABR | chr17:1082961 | chr17:729318 | ENST00000291107 | - | 1 | 22 | 301_459 | 0 | 823.0 | Domain | PH |
| Hgene | ABR | chr17:1082961 | chr17:729318 | ENST00000291107 | - | 1 | 22 | 484_613 | 0 | 823.0 | Domain | C2 |
| Hgene | ABR | chr17:1082961 | chr17:729318 | ENST00000291107 | - | 1 | 22 | 647_845 | 0 | 823.0 | Domain | Rho-GAP |
| Hgene | ABR | chr17:1082961 | chr17:729318 | ENST00000291107 | - | 1 | 22 | 91_284 | 0 | 823.0 | Domain | DH |
| Hgene | ABR | chr17:1082961 | chr17:729318 | ENST00000302538 | - | 1 | 23 | 301_459 | 20.333333333333332 | 860.0 | Domain | PH |
| Hgene | ABR | chr17:1082961 | chr17:729318 | ENST00000302538 | - | 1 | 23 | 484_613 | 20.333333333333332 | 860.0 | Domain | C2 |
| Hgene | ABR | chr17:1082961 | chr17:729318 | ENST00000302538 | - | 1 | 23 | 647_845 | 20.333333333333332 | 860.0 | Domain | Rho-GAP |
| Hgene | ABR | chr17:1082961 | chr17:729318 | ENST00000302538 | - | 1 | 23 | 91_284 | 20.333333333333332 | 860.0 | Domain | DH |
| Hgene | ABR | chr17:1082961 | chr17:729318 | ENST00000543210 | - | 1 | 8 | 301_459 | 0 | 311.0 | Domain | PH |
| Hgene | ABR | chr17:1082961 | chr17:729318 | ENST00000543210 | - | 1 | 8 | 484_613 | 0 | 311.0 | Domain | C2 |
| Hgene | ABR | chr17:1082961 | chr17:729318 | ENST00000543210 | - | 1 | 8 | 647_845 | 0 | 311.0 | Domain | Rho-GAP |
| Hgene | ABR | chr17:1082961 | chr17:729318 | ENST00000543210 | - | 1 | 8 | 91_284 | 0 | 311.0 | Domain | DH |
| Hgene | ABR | chr17:1082961 | chr17:729318 | ENST00000544583 | - | 1 | 23 | 301_459 | 0 | 814.0 | Domain | PH |
| Hgene | ABR | chr17:1082961 | chr17:729318 | ENST00000544583 | - | 1 | 23 | 484_613 | 0 | 814.0 | Domain | C2 |
| Hgene | ABR | chr17:1082961 | chr17:729318 | ENST00000544583 | - | 1 | 23 | 647_845 | 0 | 814.0 | Domain | Rho-GAP |
| Hgene | ABR | chr17:1082961 | chr17:729318 | ENST00000544583 | - | 1 | 23 | 91_284 | 0 | 814.0 | Domain | DH |
| Hgene | ABR | chr17:1082961 | chr17:729318 | ENST00000574437 | - | 1 | 22 | 301_459 | 0 | 814.0 | Domain | PH |
| Hgene | ABR | chr17:1082961 | chr17:729318 | ENST00000574437 | - | 1 | 22 | 484_613 | 0 | 814.0 | Domain | C2 |
| Hgene | ABR | chr17:1082961 | chr17:729318 | ENST00000574437 | - | 1 | 22 | 647_845 | 0 | 814.0 | Domain | Rho-GAP |
| Hgene | ABR | chr17:1082961 | chr17:729318 | ENST00000574437 | - | 1 | 22 | 91_284 | 0 | 814.0 | Domain | DH |
| Hgene | ABR | chr17:953290 | chr17:729318 | ENST00000291107 | - | 15 | 22 | 484_613 | 560.0 | 823.0 | Domain | C2 |
| Hgene | ABR | chr17:953290 | chr17:729318 | ENST00000291107 | - | 15 | 22 | 647_845 | 560.0 | 823.0 | Domain | Rho-GAP |
| Hgene | ABR | chr17:953290 | chr17:729318 | ENST00000302538 | - | 16 | 23 | 484_613 | 597.0 | 860.0 | Domain | C2 |
| Hgene | ABR | chr17:953290 | chr17:729318 | ENST00000302538 | - | 16 | 23 | 647_845 | 597.0 | 860.0 | Domain | Rho-GAP |
| Hgene | ABR | chr17:953290 | chr17:729318 | ENST00000543210 | - | 1 | 8 | 301_459 | 0 | 311.0 | Domain | PH |
| Hgene | ABR | chr17:953290 | chr17:729318 | ENST00000543210 | - | 1 | 8 | 484_613 | 0 | 311.0 | Domain | C2 |
| Hgene | ABR | chr17:953290 | chr17:729318 | ENST00000543210 | - | 1 | 8 | 647_845 | 0 | 311.0 | Domain | Rho-GAP |
| Hgene | ABR | chr17:953290 | chr17:729318 | ENST00000543210 | - | 1 | 8 | 91_284 | 0 | 311.0 | Domain | DH |
| Hgene | ABR | chr17:953290 | chr17:729318 | ENST00000544583 | - | 16 | 23 | 484_613 | 551.0 | 814.0 | Domain | C2 |
| Hgene | ABR | chr17:953290 | chr17:729318 | ENST00000544583 | - | 16 | 23 | 647_845 | 551.0 | 814.0 | Domain | Rho-GAP |
| Hgene | ABR | chr17:953290 | chr17:729318 | ENST00000574437 | - | 15 | 22 | 484_613 | 551.0 | 814.0 | Domain | C2 |
| Hgene | ABR | chr17:953290 | chr17:729318 | ENST00000574437 | - | 15 | 22 | 647_845 | 551.0 | 814.0 | Domain | Rho-GAP |
Top |
Fusion Protein Structures |
PDB and CIF files of the predicted fusion proteins * Here we show the 3D structure of the fusion proteins using Mol*. AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Model confidence is shown from the pLDDT values per residue. pLDDT corresponds to the model’s prediction of its score on the local Distance Difference Test. It is a measure of local accuracy (from AlphfaFold website). To color code individual residues, we transformed individual PDB files into CIF format. |
| Fusion protein PDB link (fusion AA seq ID in FusionPDB) | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | AA seq | Len(AA seq) |
| PDB file >>>1781_ABR_953290_NXN_729318_ranked_0.pdb | ABR | 1082961 | 953290 | ENST00000336868 | NXN | chr17 | 729318 | - | MTCSSSGSNSRAAPPRLPAAPERAGPGACWLSPAPHQAQAPAQPPPGPGVDGAAGAMAAGGRRRRPLRYQSLAALVEDSQWPFLFLVSDF SYGTDEYDGEGNEEQKGPPEGSETMPYIDESPTMSPQLSARSQGGGDGVSPTPPEGLAPGVEAGKGLEMRKLVLSGFLASEEIYINQLEA LLLPMKPLKATATTSQPVLTIQQIETIFYKIQDIYEIHKEFYDNLCPKVQQWDSQVTMGHLFQKLASQLGVYKAFVDNYKVALETAEKCS QSNNQFQKISEELKVKGPKDSKDSHTSVTMEALLYKPIDRVTRSTLVLHDLLKHTPVDHPDYPLLQDALRISQNFLSSINEDIDPRRTAV TTPKGETRQLVKDGFLVEVSESSRKLRHVFLFTDVLLCAKLKKTSAGKHQQYDCKWYIPLADLVFPSPEESEASPQVHPFPDHELEDMKM KISALKSEIQKEKANKGQSRAIERLKKKMFENEFLLLLNSPTIPFRIHNRNGKSYLFLLSSDYERSEWREAIQKLQKKDLQAFVLSSVEL QVLTGSCFKLRTVHNIPVTSNKDDDESPGLYGFLHVIVHSAKGFKQSANLYCTLEVDSFGYFVSKAKTRVFRDTAEPKWDEEFEIELEGS QSLRILCYEKCYDKTKVNKDNNEIVDKIMGKGQIQLKLWNKYRISNIPSLIFLDATTGKVVCRNGLLVIRDDPEGLEFPWGPKPFREVIA GPLLRNNGQSLESSSLEGSHVGVYFSAHWCPPCRSLTRVLVESYRKIKEAGQNFEIIFVSADRSEESFKQYFSEMPWLAVPYTDEARRSR LNRLYGIQGIPTLIMLDPQGEVITRQGRVEVLNDEDCREFPWHPKPVLELSDSNAAQLNEGPCLVLFVDSEDDGESEAAKQLIQPIAEKI | 980 |
Top |
pLDDT score distribution |
pLDDT score distribution of the predicted wild-type structures of two partner proteins from AlphaFold2* AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. |
ABR_pLDDT.png![]() |
NXN_pLDDT.png![]() |
pLDDT score distribution of the predicted fusion protein structures from AlphaFold2* AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. |
![]() |
Top |
Ramachandran Plot of Fusion Protein Structure |
Ramachandran plot of the torsional angles - phi (φ)and psi (ψ) - of the residues (amino acids) contained in this fusion protein peptide. |
| Fusion AA seq ID in FusionPDB and their Ramachandran plots |
Top |
Fusion Protein-Protein Interaction |
Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in |
Protein-protein interactors with each fusion partner protein in wild-type from validated records (BIOGRID-3.4.160) |
| Gene | PPI interactors |
Protein-protein interactors based on sequence similarity (STRING) |
| Gene | STRING network |
| ABR | |
| NXN |
- Retained interactions in fusion protein (protein functional feature from UniProt). |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
- Lost interactions due to fusion (protein functional feature from UniProt). |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
Related Drugs to ABR-NXN |
Drugs used for this fusion-positive patient. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
| Hgene | Tgene | Drug | Source | PMID |
Top |
Related Diseases to ABR-NXN |
Diseases that have this fusion gene. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
| Hgene | Tgene | Disease | Source | PMID |
Diseases associated with fusion partners. (DisGeNet 4.0) |
| Partner | Gene | Disease ID | Disease name | # pubmeds | Source |