| UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
|
|||||||
|
Fusion Protein:NFKB1-LHFPL3 |
Fusion Protein Summary |
 Fusion gene summary |
| Fusion partner gene information | Fusion gene name: NFKB1-LHFPL3 | FusionPDB ID: 58968 | FusionGDB2.0 ID: 58968 | Hgene | Tgene | Gene symbol | NFKB1 | LHFPL3 | Gene ID | 4790 | 375612 |
| Gene name | nuclear factor kappa B subunit 1 | LHFPL tetraspan subfamily member 3 | |
| Synonyms | CVID12|EBP-1|KBF1|NF-kB|NF-kB1|NF-kappa-B1|NF-kappaB|NFKB-p105|NFKB-p50|NFkappaB|p105|p50 | LHFPL4 | |
| Cytomap | 4q24 | 7q22.2-q22.3 | |
| Type of gene | protein-coding | protein-coding | |
| Description | nuclear factor NF-kappa-B p105 subunitDNA-binding factor KBF1NF-kappabetanuclear factor NF-kappa-B p50 subunitnuclear factor kappa-B DNA binding subunitnuclear factor of kappa light polypeptide gene enhancer in B-cells 1 | LHFPL tetraspan subfamily member 3 proteinLHFP-like protein 3lipoma HMGIC fusion partner-like 3 proteinlipoma HMGIC fusion partner-like 4 | |
| Modification date | 20200329 | 20200313 | |
| UniProtAcc | P19838 | Q86UP9 | |
| Ensembl transtripts involved in fusion gene | ENST ids | ENST00000226574, ENST00000394820, ENST00000505458, ENST00000510638, ENST00000600343, | ENST00000401970, ENST00000543266, ENST00000535008, ENST00000424859, |
| Fusion gene scores for assessment (based on all fusion genes of FusionGDB 2.0) | * DoF score | 12 X 10 X 8=960 | 10 X 12 X 8=960 |
| # samples | 12 | 20 | |
| ** MAII score | log2(12/960*10)=-3 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | log2(20/960*10)=-2.26303440583379 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | |
| Context (manual curation of fusion genes in FusionPDB) | PubMed: NFKB1 [Title/Abstract] AND LHFPL3 [Title/Abstract] AND fusion [Title/Abstract] | ||
| Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) | NFKB1(103446714)-LHFPL3(104546634), # samples:3 | ||
| Anticipated loss of major functional domain due to fusion event. | NFKB1-LHFPL3 seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. NFKB1-LHFPL3 seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. NFKB1-LHFPL3 seems lost the major protein functional domain in Hgene partner, which is a transcription factor due to the frame-shifted ORF. NFKB1-LHFPL3 seems lost the major protein functional domain in Hgene partner, which is a tumor suppressor due to the frame-shifted ORF. | ||
| * DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
| Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Partner | Gene | GO ID | GO term | PubMed ID |
| Hgene | NFKB1 | GO:0010629 | negative regulation of gene expression | 26687115 |
| Hgene | NFKB1 | GO:0010956 | negative regulation of calcidiol 1-monooxygenase activity | 15243130 |
| Hgene | NFKB1 | GO:0045893 | positive regulation of transcription, DNA-templated | 17426251 |
| Hgene | NFKB1 | GO:0045944 | positive regulation of transcription by RNA polymerase II | 1406630 |
| Hgene | NFKB1 | GO:1900127 | positive regulation of hyaluronan biosynthetic process | 17324121 |
| Fusion gene breakpoints across NFKB1 (5'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
 |
| Fusion gene breakpoints across LHFPL3 (3'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
 |
Top |
Fusion Gene Sample Information |
| Fusion gene information from FusionGDB2.0. |
| Fusion gene information from two resources (ChiTars 5.0 and ChimerDB 4.0) * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
| Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
| ChimerDB4 | PRAD | TCGA-G9-6377-01A | NFKB1 | chr4 | 103446714 | - | LHFPL3 | chr7 | 104546634 | + |
| ChimerDB4 | PRAD | TCGA-G9-6377-01A | NFKB1 | chr4 | 103446714 | + | LHFPL3 | chr7 | 104546634 | + |
| ChimerDB4 | PRAD | TCGA-G9-6377 | NFKB1 | chr4 | 103446714 | + | LHFPL3 | chr7 | 104546634 | + |
Top |
Fusion ORF Analysis |
| Fusion information from ORFfinder translation from full-length transcript sequence from FusionPDB. |
| Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
| ENST00000226574 | NFKB1 | chr4 | 103446714 | + | ENST00000424859 | LHFPL3 | chr7 | 104546634 | + | 1552 | 506 | 387 | 1 | 129 |
| ENST00000394820 | NFKB1 | chr4 | 103446714 | + | ENST00000424859 | LHFPL3 | chr7 | 104546634 | + | 1550 | 504 | 385 | 2 | 128 |
| ENST00000505458 | NFKB1 | chr4 | 103446714 | + | ENST00000424859 | LHFPL3 | chr7 | 104546634 | + | 1362 | 316 | 214 | 2 | 71 |
| DeepORF prediction of the coding potential based on the fusion transcript sequence of in-frame fusion genes. DeepORF is a coding potential classifier based on convolutional neural network by comparing the real Ribo-seq data. If the no-coding score < 0.5 and coding score > 0.5, then the in-frame fusion transcript is predicted as being likely translated. |
| Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
| ENST00000226574 | ENST00000424859 | NFKB1 | chr4 | 103446714 | + | LHFPL3 | chr7 | 104546634 | + | 0.928592 | 0.071407944 |
| ENST00000394820 | ENST00000424859 | NFKB1 | chr4 | 103446714 | + | LHFPL3 | chr7 | 104546634 | + | 0.90223485 | 0.09776515 |
| ENST00000505458 | ENST00000424859 | NFKB1 | chr4 | 103446714 | + | LHFPL3 | chr7 | 104546634 | + | 0.8682312 | 0.13176882 |
Top |
Fusion Amino Acid Sequences |
| For individual full-length fusion transcript sequence from FusionPDB, we ran ORFfinder and chose the longest ORF among the all predicted ones. |
| >FusionGDB ID_FusionGDB isoform ID_FGname_Hgene_Hchr_Hbp_Henst_Tgene_Tchr_Tbp_Tenst_length(fusion AA) seq_BP >58968_58968_1_NFKB1-LHFPL3_NFKB1_chr4_103446714_ENST00000226574_LHFPL3_chr7_104546634_ENST00000424859_length(amino acids)=129AA_BP= MEKEEAAAGRSPGGPECGSGRAGARRGRARPVSAAPWPQRGRREAQGARWPGGGAALLAGRLRPRRRWAPGAGPVAACRPRAAAAGGPTD -------------------------------------------------------------- >58968_58968_2_NFKB1-LHFPL3_NFKB1_chr4_103446714_ENST00000394820_LHFPL3_chr7_104546634_ENST00000424859_length(amino acids)=128AA_BP= MEKEEAAAGRSPGGPECGSGRAGARRGRARPVSAAPWPQRGRREAQGARWPGGGAALLAGRLRPRRRWAPGAGPVAACRPRAAAAGGPTD -------------------------------------------------------------- >58968_58968_3_NFKB1-LHFPL3_NFKB1_chr4_103446714_ENST00000505458_LHFPL3_chr7_104546634_ENST00000424859_length(amino acids)=71AA_BP= -------------------------------------------------------------- |
Top |
Fusion Protein Functional Features |
| Four levels of functional features of fusion genes Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr4:103446714/chr7:104546634) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
 |
| Main function of each fusion partner protein. (from UniProt) |
| Hgene | Tgene |
| NFKB1 | LHFPL3 |
| FUNCTION: NF-kappa-B is a pleiotropic transcription factor present in almost all cell types and is the endpoint of a series of signal transduction events that are initiated by a vast array of stimuli related to many biological processes such as inflammation, immunity, differentiation, cell growth, tumorigenesis and apoptosis. NF-kappa-B is a homo- or heterodimeric complex formed by the Rel-like domain-containing proteins RELA/p65, RELB, NFKB1/p105, NFKB1/p50, REL and NFKB2/p52 and the heterodimeric p65-p50 complex appears to be most abundant one. The dimers bind at kappa-B sites in the DNA of their target genes and the individual dimers have distinct preferences for different kappa-B sites that they can bind with distinguishable affinity and specificity. Different dimer combinations act as transcriptional activators or repressors, respectively. NF-kappa-B is controlled by various mechanisms of post-translational modification and subcellular compartmentalization as well as by interactions with other cofactors or corepressors. NF-kappa-B complexes are held in the cytoplasm in an inactive state complexed with members of the NF-kappa-B inhibitor (I-kappa-B) family. In a conventional activation pathway, I-kappa-B is phosphorylated by I-kappa-B kinases (IKKs) in response to different activators, subsequently degraded thus liberating the active NF-kappa-B complex which translocates to the nucleus. NF-kappa-B heterodimeric p65-p50 and RelB-p50 complexes are transcriptional activators. The NF-kappa-B p50-p50 homodimer is a transcriptional repressor, but can act as a transcriptional activator when associated with BCL3. NFKB1 appears to have dual functions such as cytoplasmic retention of attached NF-kappa-B proteins by p105 and generation of p50 by a cotranslational processing. The proteasome-mediated process ensures the production of both p50 and p105 and preserves their independent function, although processing of NFKB1/p105 also appears to occur post-translationally. p50 binds to the kappa-B consensus sequence 5'-GGRNNYYCC-3', located in the enhancer region of genes involved in immune response and acute phase reactions. In a complex with MAP3K8, NFKB1/p105 represses MAP3K8-induced MAPK signaling; active MAP3K8 is released by proteasome-dependent degradation of NFKB1/p105. {ECO:0000269|PubMed:15485931}. |
| Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
| - Retained protein feature among the 13 regional features. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
| - Not-retained protein feature among the 13 regional features. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
| Hgene | NFKB1 | chr4:103446714 | chr7:104546634 | ENST00000226574 | + | 2 | 24 | 375_433 | 13.0 | 970.0 | Compositional bias | Note=Gly-rich |
| Hgene | NFKB1 | chr4:103446714 | chr7:104546634 | ENST00000394820 | + | 2 | 24 | 375_433 | 13.0 | 969.0 | Compositional bias | Note=Gly-rich |
| Hgene | NFKB1 | chr4:103446714 | chr7:104546634 | ENST00000505458 | + | 2 | 24 | 375_433 | 13.0 | 969.0 | Compositional bias | Note=Gly-rich |
| Hgene | NFKB1 | chr4:103446714 | chr7:104546634 | ENST00000600343 | + | 1 | 17 | 375_433 | 0 | 789.0 | Compositional bias | Note=Gly-rich |
| Hgene | NFKB1 | chr4:103446714 | chr7:104546634 | ENST00000226574 | + | 2 | 24 | 42_367 | 13.0 | 970.0 | Domain | RHD |
| Hgene | NFKB1 | chr4:103446714 | chr7:104546634 | ENST00000226574 | + | 2 | 24 | 805_892 | 13.0 | 970.0 | Domain | Note=Death |
| Hgene | NFKB1 | chr4:103446714 | chr7:104546634 | ENST00000394820 | + | 2 | 24 | 42_367 | 13.0 | 969.0 | Domain | RHD |
| Hgene | NFKB1 | chr4:103446714 | chr7:104546634 | ENST00000394820 | + | 2 | 24 | 805_892 | 13.0 | 969.0 | Domain | Note=Death |
| Hgene | NFKB1 | chr4:103446714 | chr7:104546634 | ENST00000505458 | + | 2 | 24 | 42_367 | 13.0 | 969.0 | Domain | RHD |
| Hgene | NFKB1 | chr4:103446714 | chr7:104546634 | ENST00000505458 | + | 2 | 24 | 805_892 | 13.0 | 969.0 | Domain | Note=Death |
| Hgene | NFKB1 | chr4:103446714 | chr7:104546634 | ENST00000600343 | + | 1 | 17 | 42_367 | 0 | 789.0 | Domain | RHD |
| Hgene | NFKB1 | chr4:103446714 | chr7:104546634 | ENST00000600343 | + | 1 | 17 | 805_892 | 0 | 789.0 | Domain | Note=Death |
| Hgene | NFKB1 | chr4:103446714 | chr7:104546634 | ENST00000226574 | + | 2 | 24 | 360_365 | 13.0 | 970.0 | Motif | Nuclear localization signal |
| Hgene | NFKB1 | chr4:103446714 | chr7:104546634 | ENST00000394820 | + | 2 | 24 | 360_365 | 13.0 | 969.0 | Motif | Nuclear localization signal |
| Hgene | NFKB1 | chr4:103446714 | chr7:104546634 | ENST00000505458 | + | 2 | 24 | 360_365 | 13.0 | 969.0 | Motif | Nuclear localization signal |
| Hgene | NFKB1 | chr4:103446714 | chr7:104546634 | ENST00000600343 | + | 1 | 17 | 360_365 | 0 | 789.0 | Motif | Nuclear localization signal |
| Hgene | NFKB1 | chr4:103446714 | chr7:104546634 | ENST00000226574 | + | 2 | 24 | 372_394 | 13.0 | 970.0 | Region | Note=GRR |
| Hgene | NFKB1 | chr4:103446714 | chr7:104546634 | ENST00000394820 | + | 2 | 24 | 372_394 | 13.0 | 969.0 | Region | Note=GRR |
| Hgene | NFKB1 | chr4:103446714 | chr7:104546634 | ENST00000505458 | + | 2 | 24 | 372_394 | 13.0 | 969.0 | Region | Note=GRR |
| Hgene | NFKB1 | chr4:103446714 | chr7:104546634 | ENST00000600343 | + | 1 | 17 | 372_394 | 0 | 789.0 | Region | Note=GRR |
| Hgene | NFKB1 | chr4:103446714 | chr7:104546634 | ENST00000226574 | + | 2 | 24 | 542_571 | 13.0 | 970.0 | Repeat | Note=ANK 1 |
| Hgene | NFKB1 | chr4:103446714 | chr7:104546634 | ENST00000226574 | + | 2 | 24 | 581_610 | 13.0 | 970.0 | Repeat | Note=ANK 2 |
| Hgene | NFKB1 | chr4:103446714 | chr7:104546634 | ENST00000226574 | + | 2 | 24 | 614_643 | 13.0 | 970.0 | Repeat | Note=ANK 3 |
| Hgene | NFKB1 | chr4:103446714 | chr7:104546634 | ENST00000226574 | + | 2 | 24 | 650_679 | 13.0 | 970.0 | Repeat | Note=ANK 4 |
| Hgene | NFKB1 | chr4:103446714 | chr7:104546634 | ENST00000226574 | + | 2 | 24 | 684_714 | 13.0 | 970.0 | Repeat | Note=ANK 5 |
| Hgene | NFKB1 | chr4:103446714 | chr7:104546634 | ENST00000226574 | + | 2 | 24 | 718_747 | 13.0 | 970.0 | Repeat | Note=ANK 6 |
| Hgene | NFKB1 | chr4:103446714 | chr7:104546634 | ENST00000226574 | + | 2 | 24 | 771_801 | 13.0 | 970.0 | Repeat | Note=ANK 7 |
| Hgene | NFKB1 | chr4:103446714 | chr7:104546634 | ENST00000394820 | + | 2 | 24 | 542_571 | 13.0 | 969.0 | Repeat | Note=ANK 1 |
| Hgene | NFKB1 | chr4:103446714 | chr7:104546634 | ENST00000394820 | + | 2 | 24 | 581_610 | 13.0 | 969.0 | Repeat | Note=ANK 2 |
| Hgene | NFKB1 | chr4:103446714 | chr7:104546634 | ENST00000394820 | + | 2 | 24 | 614_643 | 13.0 | 969.0 | Repeat | Note=ANK 3 |
| Hgene | NFKB1 | chr4:103446714 | chr7:104546634 | ENST00000394820 | + | 2 | 24 | 650_679 | 13.0 | 969.0 | Repeat | Note=ANK 4 |
| Hgene | NFKB1 | chr4:103446714 | chr7:104546634 | ENST00000394820 | + | 2 | 24 | 684_714 | 13.0 | 969.0 | Repeat | Note=ANK 5 |
| Hgene | NFKB1 | chr4:103446714 | chr7:104546634 | ENST00000394820 | + | 2 | 24 | 718_747 | 13.0 | 969.0 | Repeat | Note=ANK 6 |
| Hgene | NFKB1 | chr4:103446714 | chr7:104546634 | ENST00000394820 | + | 2 | 24 | 771_801 | 13.0 | 969.0 | Repeat | Note=ANK 7 |
| Hgene | NFKB1 | chr4:103446714 | chr7:104546634 | ENST00000505458 | + | 2 | 24 | 542_571 | 13.0 | 969.0 | Repeat | Note=ANK 1 |
| Hgene | NFKB1 | chr4:103446714 | chr7:104546634 | ENST00000505458 | + | 2 | 24 | 581_610 | 13.0 | 969.0 | Repeat | Note=ANK 2 |
| Hgene | NFKB1 | chr4:103446714 | chr7:104546634 | ENST00000505458 | + | 2 | 24 | 614_643 | 13.0 | 969.0 | Repeat | Note=ANK 3 |
| Hgene | NFKB1 | chr4:103446714 | chr7:104546634 | ENST00000505458 | + | 2 | 24 | 650_679 | 13.0 | 969.0 | Repeat | Note=ANK 4 |
| Hgene | NFKB1 | chr4:103446714 | chr7:104546634 | ENST00000505458 | + | 2 | 24 | 684_714 | 13.0 | 969.0 | Repeat | Note=ANK 5 |
| Hgene | NFKB1 | chr4:103446714 | chr7:104546634 | ENST00000505458 | + | 2 | 24 | 718_747 | 13.0 | 969.0 | Repeat | Note=ANK 6 |
| Hgene | NFKB1 | chr4:103446714 | chr7:104546634 | ENST00000505458 | + | 2 | 24 | 771_801 | 13.0 | 969.0 | Repeat | Note=ANK 7 |
| Hgene | NFKB1 | chr4:103446714 | chr7:104546634 | ENST00000600343 | + | 1 | 17 | 542_571 | 0 | 789.0 | Repeat | Note=ANK 1 |
| Hgene | NFKB1 | chr4:103446714 | chr7:104546634 | ENST00000600343 | + | 1 | 17 | 581_610 | 0 | 789.0 | Repeat | Note=ANK 2 |
| Hgene | NFKB1 | chr4:103446714 | chr7:104546634 | ENST00000600343 | + | 1 | 17 | 614_643 | 0 | 789.0 | Repeat | Note=ANK 3 |
| Hgene | NFKB1 | chr4:103446714 | chr7:104546634 | ENST00000600343 | + | 1 | 17 | 650_679 | 0 | 789.0 | Repeat | Note=ANK 4 |
| Hgene | NFKB1 | chr4:103446714 | chr7:104546634 | ENST00000600343 | + | 1 | 17 | 684_714 | 0 | 789.0 | Repeat | Note=ANK 5 |
| Hgene | NFKB1 | chr4:103446714 | chr7:104546634 | ENST00000600343 | + | 1 | 17 | 718_747 | 0 | 789.0 | Repeat | Note=ANK 6 |
| Hgene | NFKB1 | chr4:103446714 | chr7:104546634 | ENST00000600343 | + | 1 | 17 | 771_801 | 0 | 789.0 | Repeat | Note=ANK 7 |
| Tgene | LHFPL3 | chr4:103446714 | chr7:104546634 | ENST00000424859 | 1 | 3 | 110_130 | 213.33333333333334 | 223.0 | Transmembrane | Helical | |
| Tgene | LHFPL3 | chr4:103446714 | chr7:104546634 | ENST00000424859 | 1 | 3 | 140_160 | 213.33333333333334 | 223.0 | Transmembrane | Helical | |
| Tgene | LHFPL3 | chr4:103446714 | chr7:104546634 | ENST00000424859 | 1 | 3 | 191_211 | 213.33333333333334 | 223.0 | Transmembrane | Helical | |
| Tgene | LHFPL3 | chr4:103446714 | chr7:104546634 | ENST00000424859 | 1 | 3 | 36_56 | 213.33333333333334 | 223.0 | Transmembrane | Helical |
Top |
Fusion Protein Structures |
| PDB and CIF files of the predicted fusion proteins * Here we show the 3D structure of the fusion proteins using Mol*. AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Model confidence is shown from the pLDDT values per residue. pLDDT corresponds to the model’s prediction of its score on the local Distance Difference Test. It is a measure of local accuracy (from AlphfaFold website). To color code individual residues, we transformed individual PDB files into CIF format. |
| Fusion protein PDB link (fusion AA seq ID in FusionPDB) | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | AA seq | Len(AA seq) |
| PDB file >>>63_NFKB1_103446714_LHFPL3_104546634_ranked_0.pdb | NFKB1 | 103446714 | 103446714 | ENST00000424859 | LHFPL3 | chr7 | 104546634 | + | MEKEEAAAGRSPGGPECGSGRAGARRGRARPVSAAPWPQRGRREAQGARWPGGGAALLAGRLRPRRRWAPGAGPVAACRPRAAAAGGPTD | 129 |
Top |
pLDDT score distribution |
| pLDDT score distribution of the predicted wild-type structures of two partner proteins from AlphaFold2 * AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. |
NFKB1_pLDDT.png  |
LHFPL3_pLDDT.png  |
| pLDDT score distribution of the predicted fusion protein structures from AlphaFold2 * AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. |
 |
Top |
Ramachandran Plot of Fusion Protein Structure |
| Ramachandran plot of the torsional angles - phi (φ)and psi (ψ) - of the residues (amino acids) contained in this fusion protein peptide. |
| Fusion AA seq ID in FusionPDB and their Ramachandran plots |
Top |
Fusion Protein-Protein Interaction |
| Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in |
| Protein-protein interactors with each fusion partner protein in wild-type from validated records (BIOGRID-3.4.160) |
| Gene | PPI interactors |
| Protein-protein interactors based on sequence similarity (STRING) |
| Gene | STRING network |
| NFKB1 | |
| LHFPL3 |
| - Retained interactions in fusion protein (protein functional feature from UniProt). |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
| - Lost interactions due to fusion (protein functional feature from UniProt). |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
| Hgene | NFKB1 | chr4:103446714 | chr7:104546634 | ENST00000226574 | + | 2 | 24 | 435_968 | 13.0 | 970.0 | CFLAR |
| Hgene | NFKB1 | chr4:103446714 | chr7:104546634 | ENST00000394820 | + | 2 | 24 | 435_968 | 13.0 | 969.0 | CFLAR |
| Hgene | NFKB1 | chr4:103446714 | chr7:104546634 | ENST00000505458 | + | 2 | 24 | 435_968 | 13.0 | 969.0 | CFLAR |
| Hgene | NFKB1 | chr4:103446714 | chr7:104546634 | ENST00000600343 | + | 1 | 17 | 435_968 | 0 | 789.0 | CFLAR |
Top |
Related Drugs to NFKB1-LHFPL3 |
| Drugs used for this fusion-positive patient. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
| Hgene | Tgene | Drug | Source | PMID |
Top |
Related Diseases to NFKB1-LHFPL3 |
| Diseases that have this fusion gene. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
| Hgene | Tgene | Disease | Source | PMID |
| Diseases associated with fusion partners. (DisGeNet 4.0) |
| Partner | Gene | Disease ID | Disease name | # pubmeds | Source |
Copyright 2021-Present -The University of Texas Health Science Center at Houston (UTHealth)
Web File Viewing | Emergency Information |Campus Carry|Site Policies