UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
|
Fusion Protein:ATG5-EPHA7 |
Fusion Protein Summary |
Fusion gene summary |
Fusion partner gene information | Fusion gene name: ATG5-EPHA7 | FusionPDB ID: 7592 | FusionGDB2.0 ID: 7592 | Hgene | Tgene | Gene symbol | ATG5 | EPHA7 | Gene ID | 9474 | 2045 |
Gene name | autophagy related 5 | EPH receptor A7 | |
Synonyms | APG5|APG5-LIKE|APG5L|ASP|SCAR25|hAPG5 | EHK-3|EHK3|EK11|HEK11 | |
Cytomap | 6q21 | 6q16.1 | |
Type of gene | protein-coding | protein-coding | |
Description | autophagy protein 5APG5 autophagy 5-likeATG5 autophagy related 5 homologapoptosis-specific protein | ephrin type-A receptor 7EPH homology kinase 3EPH-like kinase 11Eph homology kinase-3receptor protein-tyrosine kinase HEK11tyrosine-protein kinase receptor EHK-3 | |
Modification date | 20200313 | 20200313 | |
UniProtAcc | Q9H1Y0 | Q15375 | |
Ensembl transtripts involved in fusion gene | ENST ids | ENST00000343245, ENST00000369076, ENST00000360666, ENST00000369070, ENST00000475645, | ENST00000369297, ENST00000369303, |
Fusion gene scores for assessment (based on all fusion genes of FusionGDB 2.0) | * DoF score | 25 X 16 X 9=3600 | 3 X 3 X 2=18 |
# samples | 29 | 3 | |
** MAII score | log2(29/3600*10)=-3.6338721012021 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | log2(3/18*10)=0.736965594166206 effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs). DoF>8 and MAII>0 | |
Context (manual curation of fusion genes in FusionPDB) | PubMed: ATG5 [Title/Abstract] AND EPHA7 [Title/Abstract] AND fusion [Title/Abstract] | ||
Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) | ATG5(106756239)-EPHA7(93982140), # samples:3 | ||
Anticipated loss of major functional domain due to fusion event. | ATG5-EPHA7 seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. ATG5-EPHA7 seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. ATG5-EPHA7 seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. ATG5-EPHA7 seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. ATG5-EPHA7 seems lost the major protein functional domain in Tgene partner, which is a CGC due to the frame-shifted ORF. ATG5-EPHA7 seems lost the major protein functional domain in Tgene partner, which is a essential gene due to the frame-shifted ORF. ATG5-EPHA7 seems lost the major protein functional domain in Tgene partner, which is a IUPHAR drug target due to the frame-shifted ORF. ATG5-EPHA7 seems lost the major protein functional domain in Tgene partner, which is a kinase due to the frame-shifted ORF. |
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
Partner | Gene | GO ID | GO term | PubMed ID |
Tgene | EPHA7 | GO:0048013 | ephrin receptor signaling pathway | 17726105 |
Tgene | EPHA7 | GO:0050730 | regulation of peptidyl-tyrosine phosphorylation | 17726105 |
Tgene | EPHA7 | GO:0070372 | regulation of ERK1 and ERK2 cascade | 17726105 |
Fusion gene breakpoints across ATG5 (5'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Fusion gene breakpoints across EPHA7 (3'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Top |
Fusion Gene Sample Information |
Fusion gene information from FusionGDB2.0. |
Fusion gene information from two resources (ChiTars 5.0 and ChimerDB 4.0) * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
ChimerDB4 | LUSC | TCGA-98-A53B-01A | ATG5 | chr6 | 106756239 | - | EPHA7 | chr6 | 93982140 | - |
ChimerDB4 | LUSC | TCGA-98-A53B | ATG5 | chr6 | 106756239 | - | EPHA7 | chr6 | 93982140 | - |
Top |
Fusion ORF Analysis |
Fusion information from ORFfinder translation from full-length transcript sequence from FusionPDB. |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
ENST00000369076 | ATG5 | chr6 | 106756239 | - | ENST00000369303 | EPHA7 | chr6 | 93982140 | - | 5639 | 560 | 583 | 2232 | 549 |
DeepORF prediction of the coding potential based on the fusion transcript sequence of in-frame fusion genes. DeepORF is a coding potential classifier based on convolutional neural network by comparing the real Ribo-seq data. If the no-coding score < 0.5 and coding score > 0.5, then the in-frame fusion transcript is predicted as being likely translated. |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
ENST00000369076 | ENST00000369303 | ATG5 | chr6 | 106756239 | - | EPHA7 | chr6 | 93982140 | - | 8.92E-05 | 0.99991083 |
Top |
Fusion Amino Acid Sequences |
For individual full-length fusion transcript sequence from FusionPDB, we ran ORFfinder and chose the longest ORF among the all predicted ones. |
>FusionGDB ID_FusionGDB isoform ID_FGname_Hgene_Hchr_Hbp_Henst_Tgene_Tchr_Tbp_Tenst_length(fusion AA) seq_BP >7592_7592_1_ATG5-EPHA7_ATG5_chr6_106756239_ENST00000369076_EPHA7_chr6_93982140_ENST00000369303_length(amino acids)=549AA_BP= MKERVLQRSVELSWQEPEHPNGVITEYEIKYYEKDQRERTYSTVKTKSTSASINNLKPGTVYVFQIRAFTAAGYGNYSPRLDVATLEEAT GKMFEATAVSSEQNPVIIIAVVAVAGTIILVFMVFGFIIGRRHCGYSKADQEGDEELYFHFKFPGTKTYIDPETYEDPNRAVHQFAKELD ASCIKIERVIGAGEFGEVCSGRLKLPGKRDVAVAIKTLKVGYTEKQRRDFLCEASIMGQFDHPNVVHLEGVVTRGKPVMIVIEFMENGAL DAFLRKHDGQFTVIQLVGMLRGIAAGMRYLADMGYVHRDLAARNILVNSNLVCKVSDFGLSRVIEDDPEAVYTTTGGKIPVRWTAPEAIQ YRKFTSASDVWSYGIVMWEVMSYGERPYWDMSNQDVIKAIEEGYRLPAPMDCPAGLHQLMLDCWQKERAERPKFEQIVGILDKMIRNPNS LKTPLGTCSRPISPLLDQNTPDFTTFCSVGEWLQAIKMERYKDNFTAAGYNSLESVARMTIEDVMSLGITLVGHQKKIMSSIQTMRAQML -------------------------------------------------------------- |
Top |
Fusion Protein Functional Features |
Four levels of functional features of fusion genes Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr6:106756239/chr6:93982140) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
Main function of each fusion partner protein. (from UniProt) |
Hgene | Tgene |
ATG5 | EPHA7 |
FUNCTION: Involved in autophagic vesicle formation. Conjugation with ATG12, through a ubiquitin-like conjugating system involving ATG7 as an E1-like activating enzyme and ATG10 as an E2-like conjugating enzyme, is essential for its function. The ATG12-ATG5 conjugate acts as an E3-like enzyme which is required for lipidation of ATG8 family proteins and their association to the vesicle membranes. Involved in mitochondrial quality control after oxidative damage, and in subsequent cellular longevity. Plays a critical role in multiple aspects of lymphocyte development and is essential for both B and T lymphocyte survival and proliferation. Required for optimal processing and presentation of antigens for MHC II. Involved in the maintenance of axon morphology and membrane structures, as well as in normal adipocyte differentiation. Promotes primary ciliogenesis through removal of OFD1 from centriolar satellites and degradation of IFT20 via the autophagic pathway. {ECO:0000250|UniProtKB:Q99J83, ECO:0000269|PubMed:12207896, ECO:0000269|PubMed:20580051, ECO:0000269|PubMed:22170153, ECO:0000269|PubMed:26812546}.; FUNCTION: May play an important role in the apoptotic process, possibly within the modified cytoskeleton. Its expression is a relatively late event in the apoptotic process, occurring downstream of caspase activity. Plays a crucial role in IFN-gamma-induced autophagic cell death by interacting with FADD. {ECO:0000269|PubMed:15778222, ECO:0000269|PubMed:7796880}.; FUNCTION: (Microbial infection) May act as a proviral factor. In association with ATG12, negatively regulates the innate antiviral immune response by impairing the type I IFN production pathway upon vesicular stomatitis virus (VSV) infection (PubMed:17709747). Required for the translation of incoming hepatitis C virus (HCV) RNA and, thereby, for initiation of HCV replication, but not required once infection is established (PubMed:19666601). {ECO:0000269|PubMed:17709747, ECO:0000269|PubMed:19666601}. | FUNCTION: Receptor tyrosine kinase which binds promiscuously GPI-anchored ephrin-A family ligands residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. The signaling pathway downstream of the receptor is referred to as forward signaling while the signaling pathway downstream of the ephrin ligand is referred to as reverse signaling. Among GPI-anchored ephrin-A ligands, EFNA5 is a cognate/functional ligand for EPHA7 and their interaction regulates brain development modulating cell-cell adhesion and repulsion. Has a repellent activity on axons and is for instance involved in the guidance of corticothalamic axons and in the proper topographic mapping of retinal axons to the colliculus. May also regulate brain development through a caspase(CASP3)-dependent proapoptotic activity. Forward signaling may result in activation of components of the ERK signaling pathway including MAP2K1, MAP2K2, MAPK1 AND MAPK3 which are phosphorylated upon activation of EPHA7. {ECO:0000269|PubMed:17726105}. |
Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
- Retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Tgene | EPHA7 | chr6:106756239 | chr6:93982140 | ENST00000369297 | 0 | 3 | 192_328 | 0 | 280.0 | Compositional bias | Note=Cys-rich | |
Tgene | EPHA7 | chr6:106756239 | chr6:93982140 | ENST00000369297 | 0 | 3 | 32_210 | 0 | 280.0 | Domain | Eph LBD | |
Tgene | EPHA7 | chr6:106756239 | chr6:93982140 | ENST00000369297 | 0 | 3 | 331_441 | 0 | 280.0 | Domain | Fibronectin type-III 1 | |
Tgene | EPHA7 | chr6:106756239 | chr6:93982140 | ENST00000369297 | 0 | 3 | 442_537 | 0 | 280.0 | Domain | Fibronectin type-III 2 | |
Tgene | EPHA7 | chr6:106756239 | chr6:93982140 | ENST00000369297 | 0 | 3 | 633_894 | 0 | 280.0 | Domain | Protein kinase | |
Tgene | EPHA7 | chr6:106756239 | chr6:93982140 | ENST00000369297 | 0 | 3 | 923_987 | 0 | 280.0 | Domain | SAM | |
Tgene | EPHA7 | chr6:106756239 | chr6:93982140 | ENST00000369303 | 4 | 17 | 442_537 | 441.3333333333333 | 999.0 | Domain | Fibronectin type-III 2 | |
Tgene | EPHA7 | chr6:106756239 | chr6:93982140 | ENST00000369303 | 4 | 17 | 633_894 | 441.3333333333333 | 999.0 | Domain | Protein kinase | |
Tgene | EPHA7 | chr6:106756239 | chr6:93982140 | ENST00000369303 | 4 | 17 | 923_987 | 441.3333333333333 | 999.0 | Domain | SAM | |
Tgene | EPHA7 | chr6:106756239 | chr6:93982140 | ENST00000369297 | 0 | 3 | 996_998 | 0 | 280.0 | Motif | PDZ-binding | |
Tgene | EPHA7 | chr6:106756239 | chr6:93982140 | ENST00000369303 | 4 | 17 | 996_998 | 441.3333333333333 | 999.0 | Motif | PDZ-binding | |
Tgene | EPHA7 | chr6:106756239 | chr6:93982140 | ENST00000369297 | 0 | 3 | 639_647 | 0 | 280.0 | Nucleotide binding | ATP | |
Tgene | EPHA7 | chr6:106756239 | chr6:93982140 | ENST00000369303 | 4 | 17 | 639_647 | 441.3333333333333 | 999.0 | Nucleotide binding | ATP | |
Tgene | EPHA7 | chr6:106756239 | chr6:93982140 | ENST00000369297 | 0 | 3 | 28_555 | 0 | 280.0 | Topological domain | Extracellular | |
Tgene | EPHA7 | chr6:106756239 | chr6:93982140 | ENST00000369297 | 0 | 3 | 577_998 | 0 | 280.0 | Topological domain | Cytoplasmic | |
Tgene | EPHA7 | chr6:106756239 | chr6:93982140 | ENST00000369303 | 4 | 17 | 577_998 | 441.3333333333333 | 999.0 | Topological domain | Cytoplasmic | |
Tgene | EPHA7 | chr6:106756239 | chr6:93982140 | ENST00000369297 | 0 | 3 | 556_576 | 0 | 280.0 | Transmembrane | Helical | |
Tgene | EPHA7 | chr6:106756239 | chr6:93982140 | ENST00000369303 | 4 | 17 | 556_576 | 441.3333333333333 | 999.0 | Transmembrane | Helical |
- Not-retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Tgene | EPHA7 | chr6:106756239 | chr6:93982140 | ENST00000369303 | 4 | 17 | 192_328 | 441.3333333333333 | 999.0 | Compositional bias | Note=Cys-rich | |
Tgene | EPHA7 | chr6:106756239 | chr6:93982140 | ENST00000369303 | 4 | 17 | 32_210 | 441.3333333333333 | 999.0 | Domain | Eph LBD | |
Tgene | EPHA7 | chr6:106756239 | chr6:93982140 | ENST00000369303 | 4 | 17 | 331_441 | 441.3333333333333 | 999.0 | Domain | Fibronectin type-III 1 | |
Tgene | EPHA7 | chr6:106756239 | chr6:93982140 | ENST00000369303 | 4 | 17 | 28_555 | 441.3333333333333 | 999.0 | Topological domain | Extracellular |
Top |
Fusion Protein Structures |
PDB and CIF files of the predicted fusion proteins * Here we show the 3D structure of the fusion proteins using Mol*. AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Model confidence is shown from the pLDDT values per residue. pLDDT corresponds to the model’s prediction of its score on the local Distance Difference Test. It is a measure of local accuracy (from AlphfaFold website). To color code individual residues, we transformed individual PDB files into CIF format. |
Fusion protein PDB link (fusion AA seq ID in FusionPDB) | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | AA seq | Len(AA seq) |
PDB file >>>1174_ATG5_106756239_EPHA7_93982140_1174_ATG5_106756239_EPHA7_93982140_ranked_0.pdb | ATG5 | 106756239 | 106756239 | ENST00000369303 | EPHA7 | chr6 | 93982140 | - | MKERVLQRSVELSWQEPEHPNGVITEYEIKYYEKDQRERTYSTVKTKSTSASINNLKPGTVYVFQIRAFTAAGYGNYSPRLDVATLEEAT GKMFEATAVSSEQNPVIIIAVVAVAGTIILVFMVFGFIIGRRHCGYSKADQEGDEELYFHFKFPGTKTYIDPETYEDPNRAVHQFAKELD ASCIKIERVIGAGEFGEVCSGRLKLPGKRDVAVAIKTLKVGYTEKQRRDFLCEASIMGQFDHPNVVHLEGVVTRGKPVMIVIEFMENGAL DAFLRKHDGQFTVIQLVGMLRGIAAGMRYLADMGYVHRDLAARNILVNSNLVCKVSDFGLSRVIEDDPEAVYTTTGGKIPVRWTAPEAIQ YRKFTSASDVWSYGIVMWEVMSYGERPYWDMSNQDVIKAIEEGYRLPAPMDCPAGLHQLMLDCWQKERAERPKFEQIVGILDKMIRNPNS LKTPLGTCSRPISPLLDQNTPDFTTFCSVGEWLQAIKMERYKDNFTAAGYNSLESVARMTIEDVMSLGITLVGHQKKIMSSIQTMRAQML | 549 |
Top |
pLDDT score distribution |
pLDDT score distribution of the predicted wild-type structures of two partner proteins from AlphaFold2 * AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. |
ATG5_pLDDT.png |
EPHA7_pLDDT.png |
pLDDT score distribution of the predicted fusion protein structures from AlphaFold2 * AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. |
Top |
Ramachandran Plot of Fusion Protein Structure |
Ramachandran plot of the torsional angles - phi (φ)and psi (ψ) - of the residues (amino acids) contained in this fusion protein peptide. |
Fusion AA seq ID in FusionPDB and their Ramachandran plots |
Top |
Fusion Protein-Protein Interaction |
Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in |
Protein-protein interactors with each fusion partner protein in wild-type from validated records (BIOGRID-3.4.160) |
Gene | PPI interactors |
Protein-protein interactors based on sequence similarity (STRING) |
Gene | STRING network |
ATG5 | |
EPHA7 |
- Retained interactions in fusion protein (protein functional feature from UniProt). |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
- Lost interactions due to fusion (protein functional feature from UniProt). |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
Related Drugs to ATG5-EPHA7 |
Drugs used for this fusion-positive patient. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Drug | Source | PMID |
Top |
Related Diseases to ATG5-EPHA7 |
Diseases that have this fusion gene. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Disease | Source | PMID |
Diseases associated with fusion partners. (DisGeNet 4.0) |
Partner | Gene | Disease ID | Disease name | # pubmeds | Source |