| UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
|
|||||||
|
Fusion Protein:TP53-SLC35G6 |
Fusion Protein Summary |
Fusion gene summary |
| Fusion partner gene information | Fusion gene name: TP53-SLC35G6 | FusionPDB ID: 93239 | FusionGDB2.0 ID: 93239 | Hgene | Tgene | Gene symbol | TP53 | SLC35G6 | Gene ID | 7157 | 643664 |
| Gene name | tumor protein p53 | solute carrier family 35 member G6 | |
| Synonyms | BCC7|BMFS5|LFS1|P53|TRP53 | AMAC1L3|TMEM21B | |
| Cytomap | 17p13.1 | 17p13.1 | |
| Type of gene | protein-coding | protein-coding | |
| Description | cellular tumor antigen p53antigen NY-CO-13mutant tumor protein 53p53 tumor suppressorphosphoprotein p53transformation-related protein 53tumor protein 53tumor supressor p53 | solute carrier family 35 member G6acyl-malonyl condensing enzyme 1-like 3acyl-malonyl-condensing enzyme 1-like protein 3protein AMAC1L3transmembrane protein 21B | |
| Modification date | 20200329 | 20200313 | |
| UniProtAcc | Q12888 | . | |
| Ensembl transtripts involved in fusion gene | ENST ids | ENST00000269305, ENST00000420246, ENST00000445888, ENST00000455263, ENST00000359597, ENST00000413465, ENST00000574684, | ENST00000412468, |
| Fusion gene scores for assessment (based on all fusion genes of FusionGDB 2.0) | * DoF score | 30 X 19 X 10=5700 | 2 X 2 X 2=8 |
| # samples | 37 | 3 | |
| ** MAII score | log2(37/5700*10)=-3.94536474342315 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | log2(3/8*10)=1.90689059560852 | |
| Context (manual curation of fusion genes in FusionPDB) | PubMed: TP53 [Title/Abstract] AND SLC35G6 [Title/Abstract] AND fusion [Title/Abstract] | ||
| Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) | TP53(7578177)-SLC35G6(7385307), # samples:1 | ||
| Anticipated loss of major functional domain due to fusion event. | TP53-SLC35G6 seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. TP53-SLC35G6 seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. TP53-SLC35G6 seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. TP53-SLC35G6 seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. TP53-SLC35G6 seems lost the major protein functional domain in Hgene partner, which is a cell metabolism gene due to the frame-shifted ORF. TP53-SLC35G6 seems lost the major protein functional domain in Hgene partner, which is a CGC due to the frame-shifted ORF. TP53-SLC35G6 seems lost the major protein functional domain in Hgene partner, which is a epigenetic factor due to the frame-shifted ORF. TP53-SLC35G6 seems lost the major protein functional domain in Hgene partner, which is a essential gene due to the frame-shifted ORF. TP53-SLC35G6 seems lost the major protein functional domain in Hgene partner, which is a transcription factor due to the frame-shifted ORF. TP53-SLC35G6 seems lost the major protein functional domain in Hgene partner, which is a tumor suppressor due to the frame-shifted ORF. TP53-SLC35G6 seems lost the major protein functional domain in Tgene partner, which is a IUPHAR drug target due to the frame-shifted ORF. | ||
| * DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Partner | Gene | GO ID | GO term | PubMed ID |
| Hgene | TP53 | GO:0000733 | DNA strand renaturation | 8183576 |
| Hgene | TP53 | GO:0006355 | regulation of transcription, DNA-templated | 7587074 |
| Hgene | TP53 | GO:0006974 | cellular response to DNA damage stimulus | 14744935|15710329|17938203 |
| Hgene | TP53 | GO:0006978 | DNA damage response, signal transduction by p53 class mediator resulting in transcription of p21 class mediator | 16213212 |
| Hgene | TP53 | GO:0006983 | ER overload response | 14744935 |
| Hgene | TP53 | GO:0007050 | cell cycle arrest | 15149599 |
| Hgene | TP53 | GO:0008104 | protein localization | 16507995 |
| Hgene | TP53 | GO:0008285 | negative regulation of cell proliferation | 22783376 |
| Hgene | TP53 | GO:0010628 | positive regulation of gene expression | 15314173|20332243 |
| Hgene | TP53 | GO:0030330 | DNA damage response, signal transduction by p53 class mediator | 15149599 |
| Hgene | TP53 | GO:0031497 | chromatin assembly | 16322561 |
| Hgene | TP53 | GO:0034644 | cellular response to UV | 16213212|23629966 |
| Hgene | TP53 | GO:0036003 | positive regulation of transcription from RNA polymerase II promoter in response to stress | 30089260 |
| Hgene | TP53 | GO:0042149 | cellular response to glucose starvation | 14744935|21471221 |
| Hgene | TP53 | GO:0042771 | intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator | 14654789|14744935|17403783 |
| Hgene | TP53 | GO:0042981 | regulation of apoptotic process | 14744935 |
| Hgene | TP53 | GO:0043065 | positive regulation of apoptotic process | 12667443|15565177|20959462 |
| Hgene | TP53 | GO:0045892 | negative regulation of transcription, DNA-templated | 24051492 |
| Hgene | TP53 | GO:0045893 | positive regulation of transcription, DNA-templated | 16322561|17403783|18549481|20378837 |
| Hgene | TP53 | GO:0045899 | positive regulation of RNA polymerase II transcriptional preinitiation complex assembly | 24289924 |
| Hgene | TP53 | GO:0045944 | positive regulation of transcription by RNA polymerase II | 11672523|17145718|17310983|17599062|18549481|20959462|24652652 |
| Hgene | TP53 | GO:0051123 | RNA polymerase II preinitiation complex assembly | 24289924 |
| Hgene | TP53 | GO:0051974 | negative regulation of telomerase activity | 10597287 |
| Hgene | TP53 | GO:0065003 | protein-containing complex assembly | 12915590 |
| Hgene | TP53 | GO:0071158 | positive regulation of cell cycle arrest | 15314173 |
| Hgene | TP53 | GO:0071480 | cellular response to gamma radiation | 16213212 |
| Hgene | TP53 | GO:0072331 | signal transduction by p53 class mediator | 15314173 |
| Hgene | TP53 | GO:0072717 | cellular response to actinomycin D | 15314173 |
| Hgene | TP53 | GO:0090200 | positive regulation of release of cytochrome c from mitochondria | 14963330 |
| Hgene | TP53 | GO:0097252 | oligodendrocyte apoptotic process | 7720704 |
| Hgene | TP53 | GO:1902895 | positive regulation of pri-miRNA transcription by RNA polymerase II | 20546595 |
| Hgene | TP53 | GO:1903800 | positive regulation of production of miRNAs involved in gene silencing by miRNA | 26100857 |
| Hgene | TP53 | GO:1990248 | regulation of transcription from RNA polymerase II promoter in response to DNA damage | 30089260 |
Fusion gene breakpoints across TP53 (5'-gene)* Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
![]() |
Fusion gene breakpoints across SLC35G6 (3'-gene)* Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
![]() |
Top |
Fusion Gene Sample Information |
Fusion gene information from FusionGDB2.0. |
Fusion gene information from two resources (ChiTars 5.0 and ChimerDB 4.0)* All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
| Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
| ChimerDB4 | STAD | TCGA-CG-5725-01A | TP53 | chr17 | 7578177 | - | SLC35G6 | chr17 | 7385307 | + |
Top |
Fusion ORF Analysis |
Fusion information from ORFfinder translation from full-length transcript sequence from FusionPDB. |
| Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
| ENST00000413465 | TP53 | chr17 | 7578177 | - | ENST00000412468 | SLC35G6 | chr17 | 7385307 | + | 1749 | 672 | 0 | 1685 | 561 |
| ENST00000359597 | TP53 | chr17 | 7578177 | - | ENST00000412468 | SLC35G6 | chr17 | 7385307 | + | 1749 | 672 | 0 | 1685 | 561 |
DeepORF prediction of the coding potential based on the fusion transcript sequence of in-frame fusion genes. DeepORF is a coding potential classifier based on convolutional neural network by comparing the real Ribo-seq data. If the no-coding score < 0.5 and coding score > 0.5, then the in-frame fusion transcript is predicted as being likely translated. |
| Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
| ENST00000413465 | ENST00000412468 | TP53 | chr17 | 7578177 | - | SLC35G6 | chr17 | 7385307 | + | 0.028429419 | 0.97157055 |
| ENST00000359597 | ENST00000412468 | TP53 | chr17 | 7578177 | - | SLC35G6 | chr17 | 7385307 | + | 0.028429419 | 0.97157055 |
Top |
Fusion Amino Acid Sequences |
For individual full-length fusion transcript sequence from FusionPDB, we ran ORFfinder and chose the longest ORF among the all predicted ones. |
| >FusionGDB ID_FusionGDB isoform ID_FGname_Hgene_Hchr_Hbp_Henst_Tgene_Tchr_Tbp_Tenst_length(fusion AA) seq_BP >93239_93239_1_TP53-SLC35G6_TP53_chr17_7578177_ENST00000359597_SLC35G6_chr17_7385307_ENST00000412468_length(amino acids)=561AA_BP=0 MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGPDEAPRMPEAAPPVAPAPAAPTPAAPAPAPS WPLSSSVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEAGSHPYLNPPDSTHPSPPSAPPSLRWHQCCQPSDATNGLLVALLGG GLPAGFVGPLSHMAYQASNLPSLELLICRCLFHLPIALLLKLRGDPLLGPPDIRGRAYFYALLNVLSIGCAYSAVQVVPAGNAATVRKGS STVCSAVLTLCLESQGLSGYDWCGLLGSILGLIIIVGPGLWTLQEGITGVYTALGYGQAFVGGLALSLGLLVYRSLHFPSCLPTVAFLSG LVGLLGSVPGLFVLQPPVLPSDLPSWSCVGAVGILALVSFTCVSYAVTKAHPALVCAVLHSEVVVALILQYYMLHETVAPSDIVGAGVVL -------------------------------------------------------------- >93239_93239_2_TP53-SLC35G6_TP53_chr17_7578177_ENST00000413465_SLC35G6_chr17_7385307_ENST00000412468_length(amino acids)=561AA_BP=0 MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGPDEAPRMPEAAPPVAPAPAAPTPAAPAPAPS WPLSSSVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEAGSHPYLNPPDSTHPSPPSAPPSLRWHQCCQPSDATNGLLVALLGG GLPAGFVGPLSHMAYQASNLPSLELLICRCLFHLPIALLLKLRGDPLLGPPDIRGRAYFYALLNVLSIGCAYSAVQVVPAGNAATVRKGS STVCSAVLTLCLESQGLSGYDWCGLLGSILGLIIIVGPGLWTLQEGITGVYTALGYGQAFVGGLALSLGLLVYRSLHFPSCLPTVAFLSG LVGLLGSVPGLFVLQPPVLPSDLPSWSCVGAVGILALVSFTCVSYAVTKAHPALVCAVLHSEVVVALILQYYMLHETVAPSDIVGAGVVL -------------------------------------------------------------- |
Top |
Fusion Protein Functional Features |
Four levels of functional features of fusion genesGo to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr17:7578177/chr17:7385307) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
![]() |
Main function of each fusion partner protein. (from UniProt) |
| Hgene | Tgene |
| TP53 | . |
| FUNCTION: Double-strand break (DSB) repair protein involved in response to DNA damage, telomere dynamics and class-switch recombination (CSR) during antibody genesis (PubMed:12364621, PubMed:22553214, PubMed:23333306, PubMed:17190600, PubMed:21144835, PubMed:27153538, PubMed:28241136). Plays a key role in the repair of double-strand DNA breaks (DSBs) in response to DNA damage by promoting non-homologous end joining (NHEJ)-mediated repair of DSBs and specifically counteracting the function of the homologous recombination (HR) repair protein BRCA1 (PubMed:22553214, PubMed:23727112, PubMed:23333306, PubMed:27153538). In response to DSBs, phosphorylation by ATM promotes interaction with RIF1 and dissociation from NUDT16L1/TIRR, leading to recruitment to DSBs sites (PubMed:28241136). Recruited to DSBs sites by recognizing and binding histone H2A monoubiquitinated at 'Lys-15' (H2AK15Ub) and histone H4 dimethylated at 'Lys-20' (H4K20me2), two histone marks that are present at DSBs sites (PubMed:23760478, PubMed:27153538, PubMed:28241136, PubMed:17190600). Required for immunoglobulin class-switch recombination (CSR) during antibody genesis, a process that involves the generation of DNA DSBs (PubMed:23345425). Participates in the repair and the orientation of the broken DNA ends during CSR (By similarity). In contrast, it is not required for classic NHEJ and V(D)J recombination (By similarity). Promotes NHEJ of dysfunctional telomeres via interaction with PAXIP1 (PubMed:23727112). {ECO:0000250|UniProtKB:P70399, ECO:0000269|PubMed:12364621, ECO:0000269|PubMed:17190600, ECO:0000269|PubMed:21144835, ECO:0000269|PubMed:22553214, ECO:0000269|PubMed:23333306, ECO:0000269|PubMed:23345425, ECO:0000269|PubMed:23727112, ECO:0000269|PubMed:23760478, ECO:0000269|PubMed:27153538, ECO:0000269|PubMed:28241136}. | FUNCTION: Might normally function as a transcriptional repressor. EWS-fusion-proteins (EFPS) may play a role in the tumorigenic process. They may disturb gene expression by mimicking, or interfering with the normal function of CTD-POLII within the transcription initiation complex. They may also contribute to an aberrant activation of the fusion protein target genes. |
Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
| - Retained protein feature among the 13 regional features. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
| Hgene | TP53 | chr17:7578177 | chr17:7385307 | ENST00000269305 | - | 6 | 11 | 17_25 | 224.0 | 394.0 | Motif | Note=TADI |
| Hgene | TP53 | chr17:7578177 | chr17:7385307 | ENST00000269305 | - | 6 | 11 | 48_56 | 224.0 | 394.0 | Motif | Note=TADII |
| Hgene | TP53 | chr17:7578177 | chr17:7385307 | ENST00000420246 | - | 6 | 12 | 17_25 | 224.0 | 774.6666666666666 | Motif | Note=TADI |
| Hgene | TP53 | chr17:7578177 | chr17:7385307 | ENST00000420246 | - | 6 | 12 | 48_56 | 224.0 | 774.6666666666666 | Motif | Note=TADII |
| Hgene | TP53 | chr17:7578177 | chr17:7385307 | ENST00000445888 | - | 6 | 11 | 17_25 | 224.0 | 394.0 | Motif | Note=TADI |
| Hgene | TP53 | chr17:7578177 | chr17:7385307 | ENST00000445888 | - | 6 | 11 | 48_56 | 224.0 | 394.0 | Motif | Note=TADII |
| Hgene | TP53 | chr17:7578177 | chr17:7385307 | ENST00000455263 | - | 6 | 12 | 17_25 | 224.0 | 755.3333333333334 | Motif | Note=TADI |
| Hgene | TP53 | chr17:7578177 | chr17:7385307 | ENST00000455263 | - | 6 | 12 | 48_56 | 224.0 | 755.3333333333334 | Motif | Note=TADII |
| Hgene | TP53 | chr17:7578177 | chr17:7385307 | ENST00000269305 | - | 6 | 11 | 1_44 | 224.0 | 394.0 | Region | Note=Transcription activation (acidic) |
| Hgene | TP53 | chr17:7578177 | chr17:7385307 | ENST00000420246 | - | 6 | 12 | 1_44 | 224.0 | 774.6666666666666 | Region | Note=Transcription activation (acidic) |
| Hgene | TP53 | chr17:7578177 | chr17:7385307 | ENST00000445888 | - | 6 | 11 | 1_44 | 224.0 | 394.0 | Region | Note=Transcription activation (acidic) |
| Hgene | TP53 | chr17:7578177 | chr17:7385307 | ENST00000455263 | - | 6 | 12 | 1_44 | 224.0 | 755.3333333333334 | Region | Note=Transcription activation (acidic) |
| Tgene | SLC35G6 | chr17:7578177 | chr17:7385307 | ENST00000412468 | 0 | 2 | 272_325 | 1.0 | 339.0 | Domain | Note=EamA 2 | |
| Tgene | SLC35G6 | chr17:7578177 | chr17:7385307 | ENST00000412468 | 0 | 2 | 49_174 | 1.0 | 339.0 | Domain | Note=EamA 1 | |
| Tgene | SLC35G6 | chr17:7578177 | chr17:7385307 | ENST00000412468 | 0 | 2 | 105_125 | 1.0 | 339.0 | Transmembrane | Helical | |
| Tgene | SLC35G6 | chr17:7578177 | chr17:7385307 | ENST00000412468 | 0 | 2 | 160_180 | 1.0 | 339.0 | Transmembrane | Helical | |
| Tgene | SLC35G6 | chr17:7578177 | chr17:7385307 | ENST00000412468 | 0 | 2 | 190_210 | 1.0 | 339.0 | Transmembrane | Helical | |
| Tgene | SLC35G6 | chr17:7578177 | chr17:7385307 | ENST00000412468 | 0 | 2 | 221_241 | 1.0 | 339.0 | Transmembrane | Helical | |
| Tgene | SLC35G6 | chr17:7578177 | chr17:7385307 | ENST00000412468 | 0 | 2 | 255_275 | 1.0 | 339.0 | Transmembrane | Helical | |
| Tgene | SLC35G6 | chr17:7578177 | chr17:7385307 | ENST00000412468 | 0 | 2 | 281_301 | 1.0 | 339.0 | Transmembrane | Helical | |
| Tgene | SLC35G6 | chr17:7578177 | chr17:7385307 | ENST00000412468 | 0 | 2 | 310_330 | 1.0 | 339.0 | Transmembrane | Helical | |
| Tgene | SLC35G6 | chr17:7578177 | chr17:7385307 | ENST00000412468 | 0 | 2 | 40_60 | 1.0 | 339.0 | Transmembrane | Helical | |
| Tgene | SLC35G6 | chr17:7578177 | chr17:7385307 | ENST00000412468 | 0 | 2 | 67_87 | 1.0 | 339.0 | Transmembrane | Helical |
| - Not-retained protein feature among the 13 regional features. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
| Hgene | TP53 | chr17:7578177 | chr17:7385307 | ENST00000269305 | - | 6 | 11 | 102_292 | 224.0 | 394.0 | DNA binding | . |
| Hgene | TP53 | chr17:7578177 | chr17:7385307 | ENST00000420246 | - | 6 | 12 | 102_292 | 224.0 | 774.6666666666666 | DNA binding | . |
| Hgene | TP53 | chr17:7578177 | chr17:7385307 | ENST00000445888 | - | 6 | 11 | 102_292 | 224.0 | 394.0 | DNA binding | . |
| Hgene | TP53 | chr17:7578177 | chr17:7385307 | ENST00000455263 | - | 6 | 12 | 102_292 | 224.0 | 755.3333333333334 | DNA binding | . |
| Hgene | TP53 | chr17:7578177 | chr17:7385307 | ENST00000269305 | - | 6 | 11 | 305_321 | 224.0 | 394.0 | Motif | Note=Bipartite nuclear localization signal |
| Hgene | TP53 | chr17:7578177 | chr17:7385307 | ENST00000269305 | - | 6 | 11 | 339_350 | 224.0 | 394.0 | Motif | Note=Nuclear export signal |
| Hgene | TP53 | chr17:7578177 | chr17:7385307 | ENST00000269305 | - | 6 | 11 | 370_372 | 224.0 | 394.0 | Motif | Note=[KR]-[STA]-K motif |
| Hgene | TP53 | chr17:7578177 | chr17:7385307 | ENST00000420246 | - | 6 | 12 | 305_321 | 224.0 | 774.6666666666666 | Motif | Note=Bipartite nuclear localization signal |
| Hgene | TP53 | chr17:7578177 | chr17:7385307 | ENST00000420246 | - | 6 | 12 | 339_350 | 224.0 | 774.6666666666666 | Motif | Note=Nuclear export signal |
| Hgene | TP53 | chr17:7578177 | chr17:7385307 | ENST00000420246 | - | 6 | 12 | 370_372 | 224.0 | 774.6666666666666 | Motif | Note=[KR]-[STA]-K motif |
| Hgene | TP53 | chr17:7578177 | chr17:7385307 | ENST00000445888 | - | 6 | 11 | 305_321 | 224.0 | 394.0 | Motif | Note=Bipartite nuclear localization signal |
| Hgene | TP53 | chr17:7578177 | chr17:7385307 | ENST00000445888 | - | 6 | 11 | 339_350 | 224.0 | 394.0 | Motif | Note=Nuclear export signal |
| Hgene | TP53 | chr17:7578177 | chr17:7385307 | ENST00000445888 | - | 6 | 11 | 370_372 | 224.0 | 394.0 | Motif | Note=[KR]-[STA]-K motif |
| Hgene | TP53 | chr17:7578177 | chr17:7385307 | ENST00000455263 | - | 6 | 12 | 305_321 | 224.0 | 755.3333333333334 | Motif | Note=Bipartite nuclear localization signal |
| Hgene | TP53 | chr17:7578177 | chr17:7385307 | ENST00000455263 | - | 6 | 12 | 339_350 | 224.0 | 755.3333333333334 | Motif | Note=Nuclear export signal |
| Hgene | TP53 | chr17:7578177 | chr17:7385307 | ENST00000455263 | - | 6 | 12 | 370_372 | 224.0 | 755.3333333333334 | Motif | Note=[KR]-[STA]-K motif |
| Hgene | TP53 | chr17:7578177 | chr17:7385307 | ENST00000269305 | - | 6 | 11 | 325_356 | 224.0 | 394.0 | Region | Note=Oligomerization |
| Hgene | TP53 | chr17:7578177 | chr17:7385307 | ENST00000269305 | - | 6 | 11 | 368_387 | 224.0 | 394.0 | Region | Note=Basic (repression of DNA-binding) |
| Hgene | TP53 | chr17:7578177 | chr17:7385307 | ENST00000420246 | - | 6 | 12 | 325_356 | 224.0 | 774.6666666666666 | Region | Note=Oligomerization |
| Hgene | TP53 | chr17:7578177 | chr17:7385307 | ENST00000420246 | - | 6 | 12 | 368_387 | 224.0 | 774.6666666666666 | Region | Note=Basic (repression of DNA-binding) |
| Hgene | TP53 | chr17:7578177 | chr17:7385307 | ENST00000445888 | - | 6 | 11 | 325_356 | 224.0 | 394.0 | Region | Note=Oligomerization |
| Hgene | TP53 | chr17:7578177 | chr17:7385307 | ENST00000445888 | - | 6 | 11 | 368_387 | 224.0 | 394.0 | Region | Note=Basic (repression of DNA-binding) |
| Hgene | TP53 | chr17:7578177 | chr17:7385307 | ENST00000455263 | - | 6 | 12 | 325_356 | 224.0 | 755.3333333333334 | Region | Note=Oligomerization |
| Hgene | TP53 | chr17:7578177 | chr17:7385307 | ENST00000455263 | - | 6 | 12 | 368_387 | 224.0 | 755.3333333333334 | Region | Note=Basic (repression of DNA-binding) |
Top |
Fusion Protein-Protein Interaction |
Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in |
Protein-protein interactors with each fusion partner protein in wild-type from validated records (BIOGRID-3.4.160) |
| Gene | PPI interactors |
Protein-protein interactors based on sequence similarity (STRING) |
| Gene | STRING network |
| TP53 | |
| SLC35G6 |
- Retained interactions in fusion protein (protein functional feature from UniProt). |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
- Lost interactions due to fusion (protein functional feature from UniProt). |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
| Hgene | TP53 | chr17:7578177 | chr17:7385307 | ENST00000269305 | - | 6 | 11 | 116_292 | 224.0 | 394.0 | AXIN1 |
| Hgene | TP53 | chr17:7578177 | chr17:7385307 | ENST00000420246 | - | 6 | 12 | 116_292 | 224.0 | 774.6666666666666 | AXIN1 |
| Hgene | TP53 | chr17:7578177 | chr17:7385307 | ENST00000445888 | - | 6 | 11 | 116_292 | 224.0 | 394.0 | AXIN1 |
| Hgene | TP53 | chr17:7578177 | chr17:7385307 | ENST00000455263 | - | 6 | 12 | 116_292 | 224.0 | 755.3333333333334 | AXIN1 |
| Hgene | TP53 | chr17:7578177 | chr17:7385307 | ENST00000269305 | - | 6 | 11 | 300_393 | 224.0 | 394.0 | CARM1 |
| Hgene | TP53 | chr17:7578177 | chr17:7385307 | ENST00000420246 | - | 6 | 12 | 300_393 | 224.0 | 774.6666666666666 | CARM1 |
| Hgene | TP53 | chr17:7578177 | chr17:7385307 | ENST00000445888 | - | 6 | 11 | 300_393 | 224.0 | 394.0 | CARM1 |
| Hgene | TP53 | chr17:7578177 | chr17:7385307 | ENST00000455263 | - | 6 | 12 | 300_393 | 224.0 | 755.3333333333334 | CARM1 |
| Hgene | TP53 | chr17:7578177 | chr17:7385307 | ENST00000269305 | - | 6 | 11 | 1_320 | 224.0 | 394.0 | CCAR2 |
| Hgene | TP53 | chr17:7578177 | chr17:7385307 | ENST00000420246 | - | 6 | 12 | 1_320 | 224.0 | 774.6666666666666 | CCAR2 |
| Hgene | TP53 | chr17:7578177 | chr17:7385307 | ENST00000445888 | - | 6 | 11 | 1_320 | 224.0 | 394.0 | CCAR2 |
| Hgene | TP53 | chr17:7578177 | chr17:7385307 | ENST00000455263 | - | 6 | 12 | 1_320 | 224.0 | 755.3333333333334 | CCAR2 |
| Hgene | TP53 | chr17:7578177 | chr17:7385307 | ENST00000269305 | - | 6 | 11 | 273_280 | 224.0 | 394.0 | DNA |
| Hgene | TP53 | chr17:7578177 | chr17:7385307 | ENST00000420246 | - | 6 | 12 | 273_280 | 224.0 | 774.6666666666666 | DNA |
| Hgene | TP53 | chr17:7578177 | chr17:7385307 | ENST00000445888 | - | 6 | 11 | 273_280 | 224.0 | 394.0 | DNA |
| Hgene | TP53 | chr17:7578177 | chr17:7385307 | ENST00000455263 | - | 6 | 12 | 273_280 | 224.0 | 755.3333333333334 | DNA |
| Hgene | TP53 | chr17:7578177 | chr17:7385307 | ENST00000269305 | - | 6 | 11 | 256_294 | 224.0 | 394.0 | E4F1 |
| Hgene | TP53 | chr17:7578177 | chr17:7385307 | ENST00000420246 | - | 6 | 12 | 256_294 | 224.0 | 774.6666666666666 | E4F1 |
| Hgene | TP53 | chr17:7578177 | chr17:7385307 | ENST00000445888 | - | 6 | 11 | 256_294 | 224.0 | 394.0 | E4F1 |
| Hgene | TP53 | chr17:7578177 | chr17:7385307 | ENST00000455263 | - | 6 | 12 | 256_294 | 224.0 | 755.3333333333334 | E4F1 |
| Hgene | TP53 | chr17:7578177 | chr17:7385307 | ENST00000269305 | - | 6 | 11 | 100_370 | 224.0 | 394.0 | HIPK1 |
| Hgene | TP53 | chr17:7578177 | chr17:7385307 | ENST00000420246 | - | 6 | 12 | 100_370 | 224.0 | 774.6666666666666 | HIPK1 |
| Hgene | TP53 | chr17:7578177 | chr17:7385307 | ENST00000445888 | - | 6 | 11 | 100_370 | 224.0 | 394.0 | HIPK1 |
| Hgene | TP53 | chr17:7578177 | chr17:7385307 | ENST00000455263 | - | 6 | 12 | 100_370 | 224.0 | 755.3333333333334 | HIPK1 |
| Hgene | TP53 | chr17:7578177 | chr17:7385307 | ENST00000269305 | - | 6 | 11 | 319_360 | 224.0 | 394.0 | HIPK2 |
| Hgene | TP53 | chr17:7578177 | chr17:7385307 | ENST00000420246 | - | 6 | 12 | 319_360 | 224.0 | 774.6666666666666 | HIPK2 |
| Hgene | TP53 | chr17:7578177 | chr17:7385307 | ENST00000445888 | - | 6 | 11 | 319_360 | 224.0 | 394.0 | HIPK2 |
| Hgene | TP53 | chr17:7578177 | chr17:7385307 | ENST00000455263 | - | 6 | 12 | 319_360 | 224.0 | 755.3333333333334 | HIPK2 |
| Hgene | TP53 | chr17:7578177 | chr17:7385307 | ENST00000269305 | - | 6 | 11 | 241_248 | 224.0 | 394.0 | the 53BP2 SH3 domain |
| Hgene | TP53 | chr17:7578177 | chr17:7385307 | ENST00000420246 | - | 6 | 12 | 241_248 | 224.0 | 774.6666666666666 | the 53BP2 SH3 domain |
| Hgene | TP53 | chr17:7578177 | chr17:7385307 | ENST00000445888 | - | 6 | 11 | 241_248 | 224.0 | 394.0 | the 53BP2 SH3 domain |
| Hgene | TP53 | chr17:7578177 | chr17:7385307 | ENST00000455263 | - | 6 | 12 | 241_248 | 224.0 | 755.3333333333334 | the 53BP2 SH3 domain |
| Hgene | TP53 | chr17:7578177 | chr17:7385307 | ENST00000269305 | - | 6 | 11 | 359_363 | 224.0 | 394.0 | USP7 |
| Hgene | TP53 | chr17:7578177 | chr17:7385307 | ENST00000420246 | - | 6 | 12 | 359_363 | 224.0 | 774.6666666666666 | USP7 |
| Hgene | TP53 | chr17:7578177 | chr17:7385307 | ENST00000445888 | - | 6 | 11 | 359_363 | 224.0 | 394.0 | USP7 |
| Hgene | TP53 | chr17:7578177 | chr17:7385307 | ENST00000455263 | - | 6 | 12 | 359_363 | 224.0 | 755.3333333333334 | USP7 |
Top |
Related Drugs to TP53-SLC35G6 |
Drugs used for this fusion-positive patient. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
| Hgene | Tgene | Drug | Source | PMID |
Top |
Related Diseases to TP53-SLC35G6 |
Diseases that have this fusion gene. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
| Hgene | Tgene | Disease | Source | PMID |
Diseases associated with fusion partners. (DisGeNet 4.0) |
| Partner | Gene | Disease ID | Disease name | # pubmeds | Source |