| UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
|
|||||||
|
Fusion Protein:VRK3-TGFB1 |
Fusion Protein Summary |
Fusion gene summary |
| Fusion partner gene information | Fusion gene name: VRK3-TGFB1 | FusionPDB ID: 98549 | FusionGDB2.0 ID: 98549 | Hgene | Tgene | Gene symbol | VRK3 | TGFB1 | Gene ID | 51231 | 7040 |
| Gene name | VRK serine/threonine kinase 3 | transforming growth factor beta 1 | |
| Synonyms | - | CED|DPD1|IBDIMDE|LAP|TGF-beta1|TGFB|TGFbeta | |
| Cytomap | 19q13.33 | 19q13.2 | |
| Type of gene | protein-coding | protein-coding | |
| Description | inactive serine/threonine-protein kinase VRK3serine/threonine-protein kinase VRK3serine/threonine-protein pseudokinase VRK3vaccinia related kinase 3 | transforming growth factor beta-1 proproteinTGF-beta-1latency-associated peptideprepro-transforming growth factor beta-1transforming growth factor beta1 | |
| Modification date | 20200313 | 20200329 | |
| UniProtAcc | . | TIAF1 | |
| Ensembl transtripts involved in fusion gene | ENST ids | ENST00000424804, ENST00000316763, ENST00000377011, ENST00000593919, ENST00000594948, ENST00000601341, ENST00000601912, ENST00000443401, ENST00000594092, ENST00000599538, | ENST00000221930, |
| Fusion gene scores for assessment (based on all fusion genes of FusionGDB 2.0) | * DoF score | 7 X 6 X 4=168 | 8 X 6 X 7=336 |
| # samples | 9 | 8 | |
| ** MAII score | log2(9/168*10)=-0.900464326449086 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | log2(8/336*10)=-2.0703893278914 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | |
| Context (manual curation of fusion genes in FusionPDB) | PubMed: VRK3 [Title/Abstract] AND TGFB1 [Title/Abstract] AND fusion [Title/Abstract] | ||
| Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) | VRK3(50504047)-TGFB1(41838186), # samples:2 | ||
| Anticipated loss of major functional domain due to fusion event. | VRK3-TGFB1 seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. VRK3-TGFB1 seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. VRK3-TGFB1 seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. VRK3-TGFB1 seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. VRK3-TGFB1 seems lost the major protein functional domain in Hgene partner, which is a IUPHAR drug target due to the frame-shifted ORF. VRK3-TGFB1 seems lost the major protein functional domain in Hgene partner, which is a kinase due to the frame-shifted ORF. VRK3-TGFB1 seems lost the major protein functional domain in Tgene partner, which is a tumor suppressor due to the frame-shifted ORF. | ||
| * DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Partner | Gene | GO ID | GO term | PubMed ID |
| Tgene | TGFB1 | GO:0001837 | epithelial to mesenchymal transition | 25893292|29529050 |
| Tgene | TGFB1 | GO:0001933 | negative regulation of protein phosphorylation | 8053900 |
| Tgene | TGFB1 | GO:0001934 | positive regulation of protein phosphorylation | 18625725 |
| Tgene | TGFB1 | GO:0002062 | chondrocyte differentiation | 15040835 |
| Tgene | TGFB1 | GO:0002244 | hematopoietic progenitor cell differentiation | 15451575 |
| Tgene | TGFB1 | GO:0006611 | protein export from nucleus | 9770491|17438144|18588859 |
| Tgene | TGFB1 | GO:0006754 | ATP biosynthetic process | 10513816 |
| Tgene | TGFB1 | GO:0006796 | phosphate-containing compound metabolic process | 10513816 |
| Tgene | TGFB1 | GO:0006954 | inflammatory response | 21147091 |
| Tgene | TGFB1 | GO:0007050 | cell cycle arrest | 14555988 |
| Tgene | TGFB1 | GO:0007093 | mitotic cell cycle checkpoint | 15334054 |
| Tgene | TGFB1 | GO:0007173 | epidermal growth factor receptor signaling pathway | 18625725 |
| Tgene | TGFB1 | GO:0007179 | transforming growth factor beta receptor signaling pathway | 9389648|11157754 |
| Tgene | TGFB1 | GO:0007182 | common-partner SMAD protein phosphorylation | 20573232 |
| Tgene | TGFB1 | GO:0007183 | SMAD protein complex assembly | 17438144 |
| Tgene | TGFB1 | GO:0008284 | positive regulation of cell proliferation | 10513816|14633705 |
| Tgene | TGFB1 | GO:0008285 | negative regulation of cell proliferation | 15334054 |
| Tgene | TGFB1 | GO:0010628 | positive regulation of gene expression | 18625725|18832382|18941241|19913496|25322725|26634652|26687115|27162619|29167509 |
| Tgene | TGFB1 | GO:0010629 | negative regulation of gene expression | 19913496|20067797|22269326|25163461|26634652|29167509|29529050 |
| Tgene | TGFB1 | GO:0010718 | positive regulation of epithelial to mesenchymal transition | 17999987|18505915 |
| Tgene | TGFB1 | GO:0010763 | positive regulation of fibroblast migration | 18555217 |
| Tgene | TGFB1 | GO:0010800 | positive regulation of peptidyl-threonine phosphorylation | 18625725|19736306 |
| Tgene | TGFB1 | GO:0010862 | positive regulation of pathway-restricted SMAD protein phosphorylation | 9389648|19736306|26634652 |
| Tgene | TGFB1 | GO:0010936 | negative regulation of macrophage cytokine production | 20875417 |
| Tgene | TGFB1 | GO:0016477 | cell migration | 25893292 |
| Tgene | TGFB1 | GO:0017015 | regulation of transforming growth factor beta receptor signaling pathway | 15334054 |
| Tgene | TGFB1 | GO:0022408 | negative regulation of cell-cell adhesion | 18593713 |
| Tgene | TGFB1 | GO:0030214 | hyaluronan catabolic process | 17324121 |
| Tgene | TGFB1 | GO:0030308 | negative regulation of cell growth | 15334054 |
| Tgene | TGFB1 | GO:0030335 | positive regulation of cell migration | 19736306 |
| Tgene | TGFB1 | GO:0031293 | membrane protein intracellular domain proteolysis | 25310401 |
| Tgene | TGFB1 | GO:0031334 | positive regulation of protein complex assembly | 19366691 |
| Tgene | TGFB1 | GO:0031663 | lipopolysaccharide-mediated signaling pathway | 21147091 |
| Tgene | TGFB1 | GO:0032270 | positive regulation of cellular protein metabolic process | 15219857 |
| Tgene | TGFB1 | GO:0032355 | response to estradiol | 18039789 |
| Tgene | TGFB1 | GO:0032570 | response to progesterone | 18039789 |
| Tgene | TGFB1 | GO:0032740 | positive regulation of interleukin-17 production | 18453574 |
| Tgene | TGFB1 | GO:0032801 | receptor catabolic process | 17878231 |
| Tgene | TGFB1 | GO:0032930 | positive regulation of superoxide anion generation | 22073128 |
| Tgene | TGFB1 | GO:0032967 | positive regulation of collagen biosynthetic process | 19734317|22269326|25310401 |
| Tgene | TGFB1 | GO:0033138 | positive regulation of peptidyl-serine phosphorylation | 18625725|19736306 |
| Tgene | TGFB1 | GO:0035307 | positive regulation of protein dephosphorylation | 14555988 |
| Tgene | TGFB1 | GO:0042307 | positive regulation of protein import into nucleus | 19366691 |
| Tgene | TGFB1 | GO:0043117 | positive regulation of vascular permeability | 21168935 |
| Tgene | TGFB1 | GO:0043406 | positive regulation of MAP kinase activity | 18625725 |
| Tgene | TGFB1 | GO:0043536 | positive regulation of blood vessel endothelial cell migration | 18555217 |
| Tgene | TGFB1 | GO:0043537 | negative regulation of blood vessel endothelial cell migration | 18555217 |
| Tgene | TGFB1 | GO:0043552 | positive regulation of phosphatidylinositol 3-kinase activity | 18625725 |
| Tgene | TGFB1 | GO:0045216 | cell-cell junction organization | 18505915 |
| Tgene | TGFB1 | GO:0045599 | negative regulation of fat cell differentiation | 15040835 |
| Tgene | TGFB1 | GO:0045662 | negative regulation of myoblast differentiation | 9770491 |
| Tgene | TGFB1 | GO:0045786 | negative regulation of cell cycle | 11502704 |
| Tgene | TGFB1 | GO:0045892 | negative regulation of transcription, DNA-templated | 15702480|18832382 |
| Tgene | TGFB1 | GO:0045893 | positive regulation of transcription, DNA-templated | 9389648|14517293|15334054|16816361 |
| Tgene | TGFB1 | GO:0045918 | negative regulation of cytolysis | 24586048 |
| Tgene | TGFB1 | GO:0045930 | negative regulation of mitotic cell cycle | 14555988 |
| Tgene | TGFB1 | GO:0045944 | positive regulation of transcription by RNA polymerase II | 18832382 |
| Tgene | TGFB1 | GO:0048298 | positive regulation of isotype switching to IgA isotypes | 14988498 |
| Tgene | TGFB1 | GO:0048642 | negative regulation of skeletal muscle tissue development | 9770491 |
| Tgene | TGFB1 | GO:0050680 | negative regulation of epithelial cell proliferation | 9950587 |
| Tgene | TGFB1 | GO:0050714 | positive regulation of protein secretion | 18505915 |
| Tgene | TGFB1 | GO:0050731 | positive regulation of peptidyl-tyrosine phosphorylation | 21168935 |
| Tgene | TGFB1 | GO:0050921 | positive regulation of chemotaxis | 18555217 |
| Tgene | TGFB1 | GO:0051897 | positive regulation of protein kinase B signaling | 18625725 |
| Tgene | TGFB1 | GO:0060389 | pathway-restricted SMAD protein phosphorylation | 11157754|17999987|18453574|25893292 |
| Tgene | TGFB1 | GO:0060390 | regulation of SMAD protein signal transduction | 25893292 |
| Tgene | TGFB1 | GO:0060391 | positive regulation of SMAD protein signal transduction | 9389648|19366691|29167509 |
| Tgene | TGFB1 | GO:0070168 | negative regulation of biomineral tissue development | 26634652 |
| Tgene | TGFB1 | GO:0070374 | positive regulation of ERK1 and ERK2 cascade | 25310401 |
| Tgene | TGFB1 | GO:0070723 | response to cholesterol | 17878231 |
| Tgene | TGFB1 | GO:0071407 | cellular response to organic cyclic compound | 21147091 |
| Tgene | TGFB1 | GO:0071560 | cellular response to transforming growth factor beta stimulus | 19736306|22269326 |
| Tgene | TGFB1 | GO:0085029 | extracellular matrix assembly | 19734317 |
| Tgene | TGFB1 | GO:0090263 | positive regulation of canonical Wnt signaling pathway | 12893825|15040835 |
| Tgene | TGFB1 | GO:0097191 | extrinsic apoptotic signaling pathway | 15334054 |
| Tgene | TGFB1 | GO:1900126 | negative regulation of hyaluronan biosynthetic process | 17324121 |
| Tgene | TGFB1 | GO:1900182 | positive regulation of protein localization to nucleus | 26634652 |
| Tgene | TGFB1 | GO:1901666 | positive regulation of NAD+ ADP-ribosyltransferase activity | 22073128 |
| Tgene | TGFB1 | GO:1902895 | positive regulation of pri-miRNA transcription by RNA polymerase II | 26311719|26493107 |
| Tgene | TGFB1 | GO:1903077 | negative regulation of protein localization to plasma membrane | 21168935|24586048 |
| Tgene | TGFB1 | GO:1903800 | positive regulation of production of miRNAs involved in gene silencing by miRNA | 18548003 |
| Tgene | TGFB1 | GO:2000679 | positive regulation of transcription regulatory region DNA binding | 22073128 |
| Tgene | TGFB1 | GO:2000727 | positive regulation of cardiac muscle cell differentiation | 25163461 |
Fusion gene breakpoints across VRK3 (5'-gene)* Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
![]() |
Fusion gene breakpoints across TGFB1 (3'-gene)* Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
![]() |
Top |
Fusion Gene Sample Information |
Fusion gene information from FusionGDB2.0. |
Fusion gene information from two resources (ChiTars 5.0 and ChimerDB 4.0)* All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
| Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
| ChimerDB4 | CESC | TCGA-IR-A3LH-01A | VRK3 | chr19 | 50504046 | - | TGFB1 | chr19 | 41838185 | - |
| ChimerDB4 | CESC | TCGA-IR-A3LH-01A | VRK3 | chr19 | 50504047 | - | TGFB1 | chr19 | 41838186 | - |
| ChimerDB4 | CESC | TCGA-IR-A3LH | VRK3 | chr19 | 50504046 | - | TGFB1 | chr19 | 41838186 | - |
Top |
Fusion ORF Analysis |
Fusion information from ORFfinder translation from full-length transcript sequence from FusionPDB. |
| Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
| ENST00000599538 | VRK3 | chr19 | 50504046 | - | ENST00000221930 | TGFB1 | chr19 | 41838186 | - | 2319 | 1277 | 665 | 1318 | 217 |
| ENST00000443401 | VRK3 | chr19 | 50504046 | - | ENST00000221930 | TGFB1 | chr19 | 41838186 | - | 1592 | 550 | 88 | 591 | 167 |
| ENST00000594092 | VRK3 | chr19 | 50504046 | - | ENST00000221930 | TGFB1 | chr19 | 41838186 | - | 1779 | 737 | 125 | 778 | 217 |
| ENST00000599538 | VRK3 | chr19 | 50504047 | - | ENST00000221930 | TGFB1 | chr19 | 41838186 | - | 2319 | 1277 | 665 | 1318 | 217 |
| ENST00000443401 | VRK3 | chr19 | 50504047 | - | ENST00000221930 | TGFB1 | chr19 | 41838186 | - | 1592 | 550 | 88 | 591 | 167 |
| ENST00000594092 | VRK3 | chr19 | 50504047 | - | ENST00000221930 | TGFB1 | chr19 | 41838186 | - | 1779 | 737 | 125 | 778 | 217 |
| ENST00000599538 | VRK3 | chr19 | 50504046 | - | ENST00000221930 | TGFB1 | chr19 | 41838185 | - | 2319 | 1277 | 665 | 1318 | 217 |
| ENST00000443401 | VRK3 | chr19 | 50504046 | - | ENST00000221930 | TGFB1 | chr19 | 41838185 | - | 1592 | 550 | 88 | 591 | 167 |
| ENST00000594092 | VRK3 | chr19 | 50504046 | - | ENST00000221930 | TGFB1 | chr19 | 41838185 | - | 1779 | 737 | 125 | 778 | 217 |
DeepORF prediction of the coding potential based on the fusion transcript sequence of in-frame fusion genes. DeepORF is a coding potential classifier based on convolutional neural network by comparing the real Ribo-seq data. If the no-coding score < 0.5 and coding score > 0.5, then the in-frame fusion transcript is predicted as being likely translated. |
| Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
| ENST00000599538 | ENST00000221930 | VRK3 | chr19 | 50504046 | - | TGFB1 | chr19 | 41838186 | - | 0.16606738 | 0.8339326 |
| ENST00000443401 | ENST00000221930 | VRK3 | chr19 | 50504046 | - | TGFB1 | chr19 | 41838186 | - | 0.2255921 | 0.7744079 |
| ENST00000594092 | ENST00000221930 | VRK3 | chr19 | 50504046 | - | TGFB1 | chr19 | 41838186 | - | 0.20601052 | 0.7939894 |
| ENST00000599538 | ENST00000221930 | VRK3 | chr19 | 50504047 | - | TGFB1 | chr19 | 41838186 | - | 0.16606738 | 0.8339326 |
| ENST00000443401 | ENST00000221930 | VRK3 | chr19 | 50504047 | - | TGFB1 | chr19 | 41838186 | - | 0.2255921 | 0.7744079 |
| ENST00000594092 | ENST00000221930 | VRK3 | chr19 | 50504047 | - | TGFB1 | chr19 | 41838186 | - | 0.20601052 | 0.7939894 |
| ENST00000599538 | ENST00000221930 | VRK3 | chr19 | 50504046 | - | TGFB1 | chr19 | 41838185 | - | 0.16606738 | 0.8339326 |
| ENST00000443401 | ENST00000221930 | VRK3 | chr19 | 50504046 | - | TGFB1 | chr19 | 41838185 | - | 0.2255921 | 0.7744079 |
| ENST00000594092 | ENST00000221930 | VRK3 | chr19 | 50504046 | - | TGFB1 | chr19 | 41838185 | - | 0.20601052 | 0.7939894 |
Top |
Fusion Amino Acid Sequences |
For individual full-length fusion transcript sequence from FusionPDB, we ran ORFfinder and chose the longest ORF among the all predicted ones. |
| >FusionGDB ID_FusionGDB isoform ID_FGname_Hgene_Hchr_Hbp_Henst_Tgene_Tchr_Tbp_Tenst_length(fusion AA) seq_BP >98549_98549_1_VRK3-TGFB1_VRK3_chr19_50504046_ENST00000443401_TGFB1_chr19_41838185_ENST00000221930_length(amino acids)=167AA_BP= MISFCPDCGKSIQAAFKFCPYCGNSLPVEEHVGSQTFVNPHVSSFQGSGSRPPTPKSSPQKTRKSPQVTRGSPQKTSCSPQKTRQSPQTL -------------------------------------------------------------- >98549_98549_2_VRK3-TGFB1_VRK3_chr19_50504046_ENST00000443401_TGFB1_chr19_41838186_ENST00000221930_length(amino acids)=167AA_BP= MISFCPDCGKSIQAAFKFCPYCGNSLPVEEHVGSQTFVNPHVSSFQGSGSRPPTPKSSPQKTRKSPQVTRGSPQKTSCSPQKTRQSPQTL -------------------------------------------------------------- >98549_98549_3_VRK3-TGFB1_VRK3_chr19_50504046_ENST00000594092_TGFB1_chr19_41838185_ENST00000221930_length(amino acids)=217AA_BP= MISFCPDCGKSIQAAFKFCPYCGNSLPVEEHVGSQTFVNPHVSSFQGSKRGLNSSFETSPKKVKWSSTVTSPRLSLFSDGDSSESEDTLS SSERSKGSGSRPPTPKSSPQKTRKSPQVTRGSPQKTSCSPQKTRQSPQTLKRSRVTTSLEALPTGTVLTDKSGRQWKLKSFQTRDNQGIL -------------------------------------------------------------- >98549_98549_4_VRK3-TGFB1_VRK3_chr19_50504046_ENST00000594092_TGFB1_chr19_41838186_ENST00000221930_length(amino acids)=217AA_BP= MISFCPDCGKSIQAAFKFCPYCGNSLPVEEHVGSQTFVNPHVSSFQGSKRGLNSSFETSPKKVKWSSTVTSPRLSLFSDGDSSESEDTLS SSERSKGSGSRPPTPKSSPQKTRKSPQVTRGSPQKTSCSPQKTRQSPQTLKRSRVTTSLEALPTGTVLTDKSGRQWKLKSFQTRDNQGIL -------------------------------------------------------------- >98549_98549_5_VRK3-TGFB1_VRK3_chr19_50504046_ENST00000599538_TGFB1_chr19_41838185_ENST00000221930_length(amino acids)=217AA_BP= MISFCPDCGKSIQAAFKFCPYCGNSLPVEEHVGSQTFVNPHVSSFQGSKRGLNSSFETSPKKVKWSSTVTSPRLSLFSDGDSSESEDTLS SSERSKGSGSRPPTPKSSPQKTRKSPQVTRGSPQKTSCSPQKTRQSPQTLKRSRVTTSLEALPTGTVLTDKSGRQWKLKSFQTRDNQGIL -------------------------------------------------------------- >98549_98549_6_VRK3-TGFB1_VRK3_chr19_50504046_ENST00000599538_TGFB1_chr19_41838186_ENST00000221930_length(amino acids)=217AA_BP= MISFCPDCGKSIQAAFKFCPYCGNSLPVEEHVGSQTFVNPHVSSFQGSKRGLNSSFETSPKKVKWSSTVTSPRLSLFSDGDSSESEDTLS SSERSKGSGSRPPTPKSSPQKTRKSPQVTRGSPQKTSCSPQKTRQSPQTLKRSRVTTSLEALPTGTVLTDKSGRQWKLKSFQTRDNQGIL -------------------------------------------------------------- >98549_98549_7_VRK3-TGFB1_VRK3_chr19_50504047_ENST00000443401_TGFB1_chr19_41838186_ENST00000221930_length(amino acids)=167AA_BP= MISFCPDCGKSIQAAFKFCPYCGNSLPVEEHVGSQTFVNPHVSSFQGSGSRPPTPKSSPQKTRKSPQVTRGSPQKTSCSPQKTRQSPQTL -------------------------------------------------------------- >98549_98549_8_VRK3-TGFB1_VRK3_chr19_50504047_ENST00000594092_TGFB1_chr19_41838186_ENST00000221930_length(amino acids)=217AA_BP= MISFCPDCGKSIQAAFKFCPYCGNSLPVEEHVGSQTFVNPHVSSFQGSKRGLNSSFETSPKKVKWSSTVTSPRLSLFSDGDSSESEDTLS SSERSKGSGSRPPTPKSSPQKTRKSPQVTRGSPQKTSCSPQKTRQSPQTLKRSRVTTSLEALPTGTVLTDKSGRQWKLKSFQTRDNQGIL -------------------------------------------------------------- >98549_98549_9_VRK3-TGFB1_VRK3_chr19_50504047_ENST00000599538_TGFB1_chr19_41838186_ENST00000221930_length(amino acids)=217AA_BP= MISFCPDCGKSIQAAFKFCPYCGNSLPVEEHVGSQTFVNPHVSSFQGSKRGLNSSFETSPKKVKWSSTVTSPRLSLFSDGDSSESEDTLS SSERSKGSGSRPPTPKSSPQKTRKSPQVTRGSPQKTSCSPQKTRQSPQTLKRSRVTTSLEALPTGTVLTDKSGRQWKLKSFQTRDNQGIL -------------------------------------------------------------- |
Top |
Fusion Protein Functional Features |
Four levels of functional features of fusion genesGo to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr19:50504047/chr19:41838186) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
![]() |
Main function of each fusion partner protein. (from UniProt) |
| Hgene | Tgene |
| . | TGFB1 |
| FUNCTION: Might normally function as a transcriptional repressor. EWS-fusion-proteins (EFPS) may play a role in the tumorigenic process. They may disturb gene expression by mimicking, or interfering with the normal function of CTD-POLII within the transcription initiation complex. They may also contribute to an aberrant activation of the fusion protein target genes. | 115 |
Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
| - Retained protein feature among the 13 regional features. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
| Hgene | VRK3 | chr19:50504046 | chr19:41838185 | ENST00000316763 | - | 6 | 15 | 49_64 | 204.0 | 573.3333333333334 | Motif | Nuclear localization signal |
| Hgene | VRK3 | chr19:50504046 | chr19:41838185 | ENST00000377011 | - | 5 | 14 | 49_64 | 154.0 | 519.6666666666666 | Motif | Nuclear localization signal |
| Hgene | VRK3 | chr19:50504046 | chr19:41838185 | ENST00000594092 | - | 6 | 13 | 49_64 | 204.0 | 413.0 | Motif | Nuclear localization signal |
| Hgene | VRK3 | chr19:50504046 | chr19:41838185 | ENST00000594948 | - | 6 | 14 | 49_64 | 204.0 | 475.0 | Motif | Nuclear localization signal |
| Hgene | VRK3 | chr19:50504046 | chr19:41838185 | ENST00000599538 | - | 6 | 15 | 49_64 | 204.0 | 315.3333333333333 | Motif | Nuclear localization signal |
| Hgene | VRK3 | chr19:50504046 | chr19:41838185 | ENST00000601341 | - | 5 | 13 | 49_64 | 154.0 | 425.0 | Motif | Nuclear localization signal |
| Hgene | VRK3 | chr19:50504046 | chr19:41838186 | ENST00000316763 | - | 6 | 15 | 49_64 | 204.0 | 573.3333333333334 | Motif | Nuclear localization signal |
| Hgene | VRK3 | chr19:50504046 | chr19:41838186 | ENST00000377011 | - | 5 | 14 | 49_64 | 154.0 | 519.6666666666666 | Motif | Nuclear localization signal |
| Hgene | VRK3 | chr19:50504046 | chr19:41838186 | ENST00000594092 | - | 6 | 13 | 49_64 | 204.0 | 413.0 | Motif | Nuclear localization signal |
| Hgene | VRK3 | chr19:50504046 | chr19:41838186 | ENST00000594948 | - | 6 | 14 | 49_64 | 204.0 | 475.0 | Motif | Nuclear localization signal |
| Hgene | VRK3 | chr19:50504046 | chr19:41838186 | ENST00000599538 | - | 6 | 15 | 49_64 | 204.0 | 315.3333333333333 | Motif | Nuclear localization signal |
| Hgene | VRK3 | chr19:50504046 | chr19:41838186 | ENST00000601341 | - | 5 | 13 | 49_64 | 154.0 | 425.0 | Motif | Nuclear localization signal |
| Hgene | VRK3 | chr19:50504047 | chr19:41838186 | ENST00000316763 | - | 6 | 15 | 49_64 | 204.0 | 573.3333333333334 | Motif | Nuclear localization signal |
| Hgene | VRK3 | chr19:50504047 | chr19:41838186 | ENST00000377011 | - | 5 | 14 | 49_64 | 154.0 | 519.6666666666666 | Motif | Nuclear localization signal |
| Hgene | VRK3 | chr19:50504047 | chr19:41838186 | ENST00000594092 | - | 6 | 13 | 49_64 | 204.0 | 413.0 | Motif | Nuclear localization signal |
| Hgene | VRK3 | chr19:50504047 | chr19:41838186 | ENST00000594948 | - | 6 | 14 | 49_64 | 204.0 | 475.0 | Motif | Nuclear localization signal |
| Hgene | VRK3 | chr19:50504047 | chr19:41838186 | ENST00000599538 | - | 6 | 15 | 49_64 | 204.0 | 315.3333333333333 | Motif | Nuclear localization signal |
| Hgene | VRK3 | chr19:50504047 | chr19:41838186 | ENST00000601341 | - | 5 | 13 | 49_64 | 154.0 | 425.0 | Motif | Nuclear localization signal |
| - Not-retained protein feature among the 13 regional features. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
| Hgene | VRK3 | chr19:50504046 | chr19:41838185 | ENST00000316763 | - | 6 | 15 | 166_457 | 204.0 | 573.3333333333334 | Domain | Protein kinase |
| Hgene | VRK3 | chr19:50504046 | chr19:41838185 | ENST00000377011 | - | 5 | 14 | 166_457 | 154.0 | 519.6666666666666 | Domain | Protein kinase |
| Hgene | VRK3 | chr19:50504046 | chr19:41838185 | ENST00000594092 | - | 6 | 13 | 166_457 | 204.0 | 413.0 | Domain | Protein kinase |
| Hgene | VRK3 | chr19:50504046 | chr19:41838185 | ENST00000594948 | - | 6 | 14 | 166_457 | 204.0 | 475.0 | Domain | Protein kinase |
| Hgene | VRK3 | chr19:50504046 | chr19:41838185 | ENST00000599538 | - | 6 | 15 | 166_457 | 204.0 | 315.3333333333333 | Domain | Protein kinase |
| Hgene | VRK3 | chr19:50504046 | chr19:41838185 | ENST00000601341 | - | 5 | 13 | 166_457 | 154.0 | 425.0 | Domain | Protein kinase |
| Hgene | VRK3 | chr19:50504046 | chr19:41838186 | ENST00000316763 | - | 6 | 15 | 166_457 | 204.0 | 573.3333333333334 | Domain | Protein kinase |
| Hgene | VRK3 | chr19:50504046 | chr19:41838186 | ENST00000377011 | - | 5 | 14 | 166_457 | 154.0 | 519.6666666666666 | Domain | Protein kinase |
| Hgene | VRK3 | chr19:50504046 | chr19:41838186 | ENST00000594092 | - | 6 | 13 | 166_457 | 204.0 | 413.0 | Domain | Protein kinase |
| Hgene | VRK3 | chr19:50504046 | chr19:41838186 | ENST00000594948 | - | 6 | 14 | 166_457 | 204.0 | 475.0 | Domain | Protein kinase |
| Hgene | VRK3 | chr19:50504046 | chr19:41838186 | ENST00000599538 | - | 6 | 15 | 166_457 | 204.0 | 315.3333333333333 | Domain | Protein kinase |
| Hgene | VRK3 | chr19:50504046 | chr19:41838186 | ENST00000601341 | - | 5 | 13 | 166_457 | 154.0 | 425.0 | Domain | Protein kinase |
| Hgene | VRK3 | chr19:50504047 | chr19:41838186 | ENST00000316763 | - | 6 | 15 | 166_457 | 204.0 | 573.3333333333334 | Domain | Protein kinase |
| Hgene | VRK3 | chr19:50504047 | chr19:41838186 | ENST00000377011 | - | 5 | 14 | 166_457 | 154.0 | 519.6666666666666 | Domain | Protein kinase |
| Hgene | VRK3 | chr19:50504047 | chr19:41838186 | ENST00000594092 | - | 6 | 13 | 166_457 | 204.0 | 413.0 | Domain | Protein kinase |
| Hgene | VRK3 | chr19:50504047 | chr19:41838186 | ENST00000594948 | - | 6 | 14 | 166_457 | 204.0 | 475.0 | Domain | Protein kinase |
| Hgene | VRK3 | chr19:50504047 | chr19:41838186 | ENST00000599538 | - | 6 | 15 | 166_457 | 204.0 | 315.3333333333333 | Domain | Protein kinase |
| Hgene | VRK3 | chr19:50504047 | chr19:41838186 | ENST00000601341 | - | 5 | 13 | 166_457 | 154.0 | 425.0 | Domain | Protein kinase |
| Tgene | TGFB1 | chr19:50504046 | chr19:41838185 | ENST00000221930 | 4 | 7 | 244_246 | 286.6666666666667 | 391.0 | Motif | Cell attachment site | |
| Tgene | TGFB1 | chr19:50504046 | chr19:41838186 | ENST00000221930 | 4 | 7 | 244_246 | 286.6666666666667 | 391.0 | Motif | Cell attachment site | |
| Tgene | TGFB1 | chr19:50504047 | chr19:41838186 | ENST00000221930 | 4 | 7 | 244_246 | 286.6666666666667 | 391.0 | Motif | Cell attachment site | |
| Tgene | TGFB1 | chr19:50504046 | chr19:41838185 | ENST00000221930 | 4 | 7 | 226_252 | 286.6666666666667 | 391.0 | Region | Bowtie tail | |
| Tgene | TGFB1 | chr19:50504046 | chr19:41838185 | ENST00000221930 | 4 | 7 | 30_74 | 286.6666666666667 | 391.0 | Region | Straightjacket domain | |
| Tgene | TGFB1 | chr19:50504046 | chr19:41838185 | ENST00000221930 | 4 | 7 | 75_271 | 286.6666666666667 | 391.0 | Region | Arm domain | |
| Tgene | TGFB1 | chr19:50504046 | chr19:41838186 | ENST00000221930 | 4 | 7 | 226_252 | 286.6666666666667 | 391.0 | Region | Bowtie tail | |
| Tgene | TGFB1 | chr19:50504046 | chr19:41838186 | ENST00000221930 | 4 | 7 | 30_74 | 286.6666666666667 | 391.0 | Region | Straightjacket domain | |
| Tgene | TGFB1 | chr19:50504046 | chr19:41838186 | ENST00000221930 | 4 | 7 | 75_271 | 286.6666666666667 | 391.0 | Region | Arm domain | |
| Tgene | TGFB1 | chr19:50504047 | chr19:41838186 | ENST00000221930 | 4 | 7 | 226_252 | 286.6666666666667 | 391.0 | Region | Bowtie tail | |
| Tgene | TGFB1 | chr19:50504047 | chr19:41838186 | ENST00000221930 | 4 | 7 | 30_74 | 286.6666666666667 | 391.0 | Region | Straightjacket domain | |
| Tgene | TGFB1 | chr19:50504047 | chr19:41838186 | ENST00000221930 | 4 | 7 | 75_271 | 286.6666666666667 | 391.0 | Region | Arm domain |
Top |
Fusion Protein-Protein Interaction |
Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in |
Protein-protein interactors with each fusion partner protein in wild-type from validated records (BIOGRID-3.4.160) |
| Gene | PPI interactors |
Protein-protein interactors based on sequence similarity (STRING) |
| Gene | STRING network |
| VRK3 | |
| TGFB1 |
- Retained interactions in fusion protein (protein functional feature from UniProt). |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
- Lost interactions due to fusion (protein functional feature from UniProt). |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
Related Drugs to VRK3-TGFB1 |
Drugs used for this fusion-positive patient. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
| Hgene | Tgene | Drug | Source | PMID |
Top |
Related Diseases to VRK3-TGFB1 |
Diseases that have this fusion gene. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
| Hgene | Tgene | Disease | Source | PMID |
Diseases associated with fusion partners. (DisGeNet 4.0) |
| Partner | Gene | Disease ID | Disease name | # pubmeds | Source |