UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
![]() |
|||||||
|
Fusion Protein:C9orf85-FXN |
Fusion Protein Summary |
![]() |
Fusion partner gene information | Fusion gene name: C9orf85-FXN | FusionPDB ID: 12149 | FusionGDB2.0 ID: 12149 | Hgene | Tgene | Gene symbol | C9orf85 | FXN | Gene ID | 138241 | 2395 |
Gene name | chromosome 9 open reading frame 85 | frataxin | |
Synonyms | - | CyaY|FA|FARR|FRDA|X25 | |
Cytomap | 9q21.13 | 9q21.11 | |
Type of gene | protein-coding | protein-coding | |
Description | uncharacterized protein C9orf85 | frataxin, mitochondrialFriedreich ataxia protein | |
Modification date | 20200313 | 20200315 | |
UniProtAcc | Q96MD7 | Q16595 | |
Ensembl transtripts involved in fusion gene | ENST ids | ENST00000334731, ENST00000377031, ENST00000486911, | ENST00000377270, ENST00000396364, ENST00000396366, ENST00000498653, |
Fusion gene scores for assessment (based on all fusion genes of FusionGDB 2.0) | * DoF score | 7 X 5 X 3=105 | 8 X 8 X 7=448 |
# samples | 7 | 10 | |
** MAII score | log2(7/105*10)=-0.584962500721156 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | log2(10/448*10)=-2.16349873228288 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | |
Context (manual curation of fusion genes in FusionPDB) | PubMed: C9orf85 [Title/Abstract] AND FXN [Title/Abstract] AND fusion [Title/Abstract] | ||
Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) | C9orf85(74526752)-FXN(71679854), # samples:2 | ||
Anticipated loss of major functional domain due to fusion event. | C9orf85-FXN seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. C9orf85-FXN seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. |
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
![]() |
Partner | Gene | GO ID | GO term | PubMed ID |
Tgene | FXN | GO:0010722 | regulation of ferrochelatase activity | 15123683 |
Tgene | FXN | GO:0016226 | iron-sulfur cluster assembly | 29491838 |
Tgene | FXN | GO:0016540 | protein autoprocessing | 12785837 |
Tgene | FXN | GO:0018283 | iron incorporation into metallo-sulfur cluster | 12785837 |
Tgene | FXN | GO:0051349 | positive regulation of lyase activity | 20053667 |
Tgene | FXN | GO:0070301 | cellular response to hydrogen peroxide | 15641778 |
![]() * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
![]() |
![]() * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
![]() |
Top |
Fusion Gene Sample Information |
![]() |
![]() * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
ChimerDB4 | SKCM | TCGA-FS-A1ZP-06A | C9orf85 | chr9 | 74526752 | + | FXN | chr9 | 71679854 | + |
Top |
Fusion ORF Analysis |
![]() |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
ENST00000334731 | C9orf85 | chr9 | 74526752 | + | ENST00000396364 | FXN | chr9 | 71679854 | + | 668 | 292 | 285 | 1 | 95 |
ENST00000334731 | C9orf85 | chr9 | 74526752 | + | ENST00000377270 | FXN | chr9 | 71679854 | + | 1992 | 292 | 178 | 540 | 120 |
ENST00000334731 | C9orf85 | chr9 | 74526752 | + | ENST00000396366 | FXN | chr9 | 71679854 | + | 809 | 292 | 178 | 498 | 106 |
ENST00000334731 | C9orf85 | chr9 | 74526752 | + | ENST00000498653 | FXN | chr9 | 71679854 | + | 884 | 292 | 178 | 540 | 120 |
ENST00000377031 | C9orf85 | chr9 | 74526752 | + | ENST00000396364 | FXN | chr9 | 71679854 | + | 668 | 292 | 285 | 1 | 95 |
ENST00000377031 | C9orf85 | chr9 | 74526752 | + | ENST00000377270 | FXN | chr9 | 71679854 | + | 1992 | 292 | 178 | 540 | 120 |
ENST00000377031 | C9orf85 | chr9 | 74526752 | + | ENST00000396366 | FXN | chr9 | 71679854 | + | 809 | 292 | 178 | 498 | 106 |
ENST00000377031 | C9orf85 | chr9 | 74526752 | + | ENST00000498653 | FXN | chr9 | 71679854 | + | 884 | 292 | 178 | 540 | 120 |
ENST00000486911 | C9orf85 | chr9 | 74526752 | + | ENST00000396364 | FXN | chr9 | 71679854 | + | 552 | 176 | 62 | 307 | 81 |
ENST00000486911 | C9orf85 | chr9 | 74526752 | + | ENST00000377270 | FXN | chr9 | 71679854 | + | 1876 | 176 | 62 | 424 | 120 |
ENST00000486911 | C9orf85 | chr9 | 74526752 | + | ENST00000396366 | FXN | chr9 | 71679854 | + | 693 | 176 | 62 | 382 | 106 |
ENST00000486911 | C9orf85 | chr9 | 74526752 | + | ENST00000498653 | FXN | chr9 | 71679854 | + | 768 | 176 | 62 | 424 | 120 |
![]() |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
ENST00000334731 | ENST00000396364 | C9orf85 | chr9 | 74526752 | + | FXN | chr9 | 71679854 | + | 0.5241358 | 0.47586417 |
ENST00000334731 | ENST00000377270 | C9orf85 | chr9 | 74526752 | + | FXN | chr9 | 71679854 | + | 0.0530824 | 0.94691765 |
ENST00000334731 | ENST00000396366 | C9orf85 | chr9 | 74526752 | + | FXN | chr9 | 71679854 | + | 0.08747691 | 0.91252315 |
ENST00000334731 | ENST00000498653 | C9orf85 | chr9 | 74526752 | + | FXN | chr9 | 71679854 | + | 0.023234805 | 0.9767652 |
ENST00000377031 | ENST00000396364 | C9orf85 | chr9 | 74526752 | + | FXN | chr9 | 71679854 | + | 0.5241358 | 0.47586417 |
ENST00000377031 | ENST00000377270 | C9orf85 | chr9 | 74526752 | + | FXN | chr9 | 71679854 | + | 0.0530824 | 0.94691765 |
ENST00000377031 | ENST00000396366 | C9orf85 | chr9 | 74526752 | + | FXN | chr9 | 71679854 | + | 0.08747691 | 0.91252315 |
ENST00000377031 | ENST00000498653 | C9orf85 | chr9 | 74526752 | + | FXN | chr9 | 71679854 | + | 0.023234805 | 0.9767652 |
ENST00000486911 | ENST00000396364 | C9orf85 | chr9 | 74526752 | + | FXN | chr9 | 71679854 | + | 0.23994747 | 0.76005256 |
ENST00000486911 | ENST00000377270 | C9orf85 | chr9 | 74526752 | + | FXN | chr9 | 71679854 | + | 0.028759072 | 0.97124094 |
ENST00000486911 | ENST00000396366 | C9orf85 | chr9 | 74526752 | + | FXN | chr9 | 71679854 | + | 0.054709453 | 0.9452906 |
ENST00000486911 | ENST00000498653 | C9orf85 | chr9 | 74526752 | + | FXN | chr9 | 71679854 | + | 0.015120322 | 0.9848797 |
Top |
Fusion Amino Acid Sequences |
![]() |
>FusionGDB ID_FusionGDB isoform ID_FGname_Hgene_Hchr_Hbp_Henst_Tgene_Tchr_Tbp_Tenst_length(fusion AA) seq_BP >12149_12149_1_C9orf85-FXN_C9orf85_chr9_74526752_ENST00000334731_FXN_chr9_71679854_ENST00000377270_length(amino acids)=120AA_BP=38 MISAMSSQKGNVARSRPQKHQNTFSFKNDKFDKSVQTKSGVLTVKLGGDLGTYVINKQTPNKQIWLSSPSSGPKRYDWTGKNWVYSHDGV -------------------------------------------------------------- >12149_12149_2_C9orf85-FXN_C9orf85_chr9_74526752_ENST00000334731_FXN_chr9_71679854_ENST00000396364_length(amino acids)=95AA_BP= MHTFIELVIFEAKRILVLLRSGTSHVAFLGAHRRNQSHPSPGAGKRMRGKKTNELLPGIDASVNDPEETNAAFPPRLWVSPRDSSGRSKS -------------------------------------------------------------- >12149_12149_3_C9orf85-FXN_C9orf85_chr9_74526752_ENST00000334731_FXN_chr9_71679854_ENST00000396366_length(amino acids)=106AA_BP=38 MISAMSSQKGNVARSRPQKHQNTFSFKNDKFDKSVQTKSGVLTVKLGGDLGTYVINKQTPNKQIWLSSPSRYVVDLSVMTGLGKTGCTPT -------------------------------------------------------------- >12149_12149_4_C9orf85-FXN_C9orf85_chr9_74526752_ENST00000334731_FXN_chr9_71679854_ENST00000498653_length(amino acids)=120AA_BP=38 MISAMSSQKGNVARSRPQKHQNTFSFKNDKFDKSVQTKSGVLTVKLGGDLGTYVINKQTPNKQIWLSSPSSGPKRYDWTGKNWVYSHDGV -------------------------------------------------------------- >12149_12149_5_C9orf85-FXN_C9orf85_chr9_74526752_ENST00000377031_FXN_chr9_71679854_ENST00000377270_length(amino acids)=120AA_BP=38 MISAMSSQKGNVARSRPQKHQNTFSFKNDKFDKSVQTKSGVLTVKLGGDLGTYVINKQTPNKQIWLSSPSSGPKRYDWTGKNWVYSHDGV -------------------------------------------------------------- >12149_12149_6_C9orf85-FXN_C9orf85_chr9_74526752_ENST00000377031_FXN_chr9_71679854_ENST00000396364_length(amino acids)=95AA_BP= MHTFIELVIFEAKRILVLLRSGTSHVAFLGAHRRNQSHPSPGAGKRMRGKKTNELLPGIDASVNDPEETNAAFPPRLWVSPRDSSGRSKS -------------------------------------------------------------- >12149_12149_7_C9orf85-FXN_C9orf85_chr9_74526752_ENST00000377031_FXN_chr9_71679854_ENST00000396366_length(amino acids)=106AA_BP=38 MISAMSSQKGNVARSRPQKHQNTFSFKNDKFDKSVQTKSGVLTVKLGGDLGTYVINKQTPNKQIWLSSPSRYVVDLSVMTGLGKTGCTPT -------------------------------------------------------------- >12149_12149_8_C9orf85-FXN_C9orf85_chr9_74526752_ENST00000377031_FXN_chr9_71679854_ENST00000498653_length(amino acids)=120AA_BP=38 MISAMSSQKGNVARSRPQKHQNTFSFKNDKFDKSVQTKSGVLTVKLGGDLGTYVINKQTPNKQIWLSSPSSGPKRYDWTGKNWVYSHDGV -------------------------------------------------------------- >12149_12149_9_C9orf85-FXN_C9orf85_chr9_74526752_ENST00000486911_FXN_chr9_71679854_ENST00000377270_length(amino acids)=120AA_BP=38 MISAMSSQKGNVARSRPQKHQNTFSFKNDKFDKSVQTKSGVLTVKLGGDLGTYVINKQTPNKQIWLSSPSSGPKRYDWTGKNWVYSHDGV -------------------------------------------------------------- >12149_12149_10_C9orf85-FXN_C9orf85_chr9_74526752_ENST00000486911_FXN_chr9_71679854_ENST00000396364_length(amino acids)=81AA_BP=38 -------------------------------------------------------------- >12149_12149_11_C9orf85-FXN_C9orf85_chr9_74526752_ENST00000486911_FXN_chr9_71679854_ENST00000396366_length(amino acids)=106AA_BP=38 MISAMSSQKGNVARSRPQKHQNTFSFKNDKFDKSVQTKSGVLTVKLGGDLGTYVINKQTPNKQIWLSSPSRYVVDLSVMTGLGKTGCTPT -------------------------------------------------------------- >12149_12149_12_C9orf85-FXN_C9orf85_chr9_74526752_ENST00000486911_FXN_chr9_71679854_ENST00000498653_length(amino acids)=120AA_BP=38 MISAMSSQKGNVARSRPQKHQNTFSFKNDKFDKSVQTKSGVLTVKLGGDLGTYVINKQTPNKQIWLSSPSSGPKRYDWTGKNWVYSHDGV -------------------------------------------------------------- |
Top |
Fusion Protein Functional Features |
![]() Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr9:74526752/chr9:71679854) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
![]() |
![]() |
Hgene | Tgene |
C9orf85 | FXN |
FUNCTION: Promotes the biosynthesis of heme and assembly and repair of iron-sulfur clusters by delivering Fe(2+) to proteins involved in these pathways. May play a role in the protection against iron-catalyzed oxidative stress through its ability to catalyze the oxidation of Fe(2+) to Fe(3+); the oligomeric form but not the monomeric form has in vitro ferroxidase activity. May be able to store large amounts of iron in the form of a ferrihydrite mineral by oligomerization; however, the physiological relevance is unsure as reports are conflicting and the function has only been shown using heterologous overexpression systems. Modulates the RNA-binding activity of ACO1. {ECO:0000269|PubMed:12785837, ECO:0000269|PubMed:15247478, ECO:0000269|PubMed:15641778, ECO:0000269|PubMed:16239244, ECO:0000269|PubMed:16608849, ECO:0000269|PubMed:20053667}. |
![]() |
- Retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
- Not-retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Hgene | C9orf85 | chr9:74526752 | chr9:71679854 | ENST00000334731 | + | 1 | 4 | 23_79 | 34.0 | 158.0 | Compositional bias | Note=Lys-rich |
Hgene | C9orf85 | chr9:74526752 | chr9:71679854 | ENST00000377031 | + | 1 | 4 | 23_79 | 34.0 | 180.0 | Compositional bias | Note=Lys-rich |
Top |
Fusion Protein-Protein Interaction |
![]() |
![]() |
Gene | PPI interactors |
![]() |
Gene | STRING network |
C9orf85 | |
FXN |
![]() |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
![]() |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
Related Drugs to C9orf85-FXN |
![]() (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Drug | Source | PMID |
Top |
Related Diseases to C9orf85-FXN |
![]() (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Disease | Source | PMID |
![]() (DisGeNet 4.0) |
Partner | Gene | Disease ID | Disease name | # pubmeds | Source |