| UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
|
|||||||
|
Fusion Protein:CARD11-FSCN1 |
Fusion Protein Summary |
 Fusion gene summary |
| Fusion partner gene information | Fusion gene name: CARD11-FSCN1 | FusionPDB ID: 13023 | FusionGDB2.0 ID: 13023 | Hgene | Tgene | Gene symbol | CARD11 | FSCN1 | Gene ID | 84433 | 6624 |
| Gene name | caspase recruitment domain family member 11 | fascin actin-bundling protein 1 | |
| Synonyms | BENTA|BIMP3|CARMA1|IMD11|IMD11A|PPBL | FAN1|HSN|SNL|p55 | |
| Cytomap | 7p22.2 | 7p22.1 | |
| Type of gene | protein-coding | protein-coding | |
| Description | caspase recruitment domain-containing protein 11CARD-containing MAGUK protein 1bcl10-interacting maguk protein 3carma 1 | fascin55 kDa actin-bundling proteinepididymis secretory sperm binding proteinfascin homolog 1, actin-bundling proteinsinged-like (fascin homolog, sea urchin) | |
| Modification date | 20200313 | 20200313 | |
| UniProtAcc | Q9BXL7 | Q16658 | |
| Ensembl transtripts involved in fusion gene | ENST ids | ENST00000396946, | ENST00000340250, ENST00000382361, |
| Fusion gene scores for assessment (based on all fusion genes of FusionGDB 2.0) | * DoF score | 6 X 5 X 5=150 | 4 X 3 X 3=36 |
| # samples | 6 | 4 | |
| ** MAII score | log2(6/150*10)=-1.32192809488736 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | log2(4/36*10)=0.15200309344505 effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs). DoF>8 and MAII>0 | |
| Context (manual curation of fusion genes in FusionPDB) | PubMed: CARD11 [Title/Abstract] AND FSCN1 [Title/Abstract] AND fusion [Title/Abstract] | ||
| Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) | CARD11(2972168)-FSCN1(5642887), # samples:1 | ||
| Anticipated loss of major functional domain due to fusion event. | CARD11-FSCN1 seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. CARD11-FSCN1 seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. CARD11-FSCN1 seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. CARD11-FSCN1 seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. | ||
| * DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
| Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Partner | Gene | GO ID | GO term | PubMed ID |
| Hgene | CARD11 | GO:0031295 | T cell costimulation | 17287217 |
| Tgene | FSCN1 | GO:0007043 | cell-cell junction assembly | 9571235 |
| Tgene | FSCN1 | GO:0010592 | positive regulation of lamellipodium assembly | 9571235 |
| Tgene | FSCN1 | GO:0030035 | microspike assembly | 9571235 |
| Tgene | FSCN1 | GO:0030036 | actin cytoskeleton organization | 9571235 |
| Tgene | FSCN1 | GO:0030046 | parallel actin filament bundle assembly | 21685497 |
| Tgene | FSCN1 | GO:0032534 | regulation of microvillus assembly | 9571235 |
| Tgene | FSCN1 | GO:0032956 | regulation of actin cytoskeleton organization | 20137952 |
| Tgene | FSCN1 | GO:0035089 | establishment of apical/basal cell polarity | 9571235 |
| Tgene | FSCN1 | GO:0048870 | cell motility | 9571235 |
| Tgene | FSCN1 | GO:0051017 | actin filament bundle assembly | 20393565 |
| Tgene | FSCN1 | GO:0051491 | positive regulation of filopodium assembly | 9571235|21685497 |
| Tgene | FSCN1 | GO:0071803 | positive regulation of podosome assembly | 20137952 |
| Tgene | FSCN1 | GO:0090091 | positive regulation of extracellular matrix disassembly | 20137952 |
| Fusion gene breakpoints across CARD11 (5'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
 |
| Fusion gene breakpoints across FSCN1 (3'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
 |
Top |
Fusion Gene Sample Information |
| Fusion gene information from FusionGDB2.0. |
| Fusion gene information from two resources (ChiTars 5.0 and ChimerDB 4.0) * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
| Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
| ChimerDB4 | LUSC | TCGA-66-2768 | CARD11 | chr7 | 2972168 | - | FSCN1 | chr7 | 5642887 | + |
Top |
Fusion ORF Analysis |
| Fusion information from ORFfinder translation from full-length transcript sequence from FusionPDB. |
| Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
| ENST00000396946 | CARD11 | chr7 | 2972168 | - | ENST00000340250 | FSCN1 | chr7 | 5642887 | + | 3798 | 1974 | 404 | 2623 | 739 |
| ENST00000396946 | CARD11 | chr7 | 2972168 | - | ENST00000382361 | FSCN1 | chr7 | 5642887 | + | 3805 | 1974 | 404 | 2623 | 739 |
| DeepORF prediction of the coding potential based on the fusion transcript sequence of in-frame fusion genes. DeepORF is a coding potential classifier based on convolutional neural network by comparing the real Ribo-seq data. If the no-coding score < 0.5 and coding score > 0.5, then the in-frame fusion transcript is predicted as being likely translated. |
| Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
| ENST00000396946 | ENST00000340250 | CARD11 | chr7 | 2972168 | - | FSCN1 | chr7 | 5642887 | + | 0.01273374 | 0.98726624 |
| ENST00000396946 | ENST00000382361 | CARD11 | chr7 | 2972168 | - | FSCN1 | chr7 | 5642887 | + | 0.012825186 | 0.9871748 |
Top |
Fusion Amino Acid Sequences |
| For individual full-length fusion transcript sequence from FusionPDB, we ran ORFfinder and chose the longest ORF among the all predicted ones. |
| >FusionGDB ID_FusionGDB isoform ID_FGname_Hgene_Hchr_Hbp_Henst_Tgene_Tchr_Tbp_Tenst_length(fusion AA) seq_BP >13023_13023_1_CARD11-FSCN1_CARD11_chr7_2972168_ENST00000396946_FSCN1_chr7_5642887_ENST00000340250_length(amino acids)=739AA_BP=523 MPGGGPEMDDYMETLKDEEDALWENVECNRHMLSRYINPAKLTPYLRQCKVIDEQDEDEVLNAPMLPSKINRAGRLLDILHTKGQRGYVV FLESLEFYYPELYKLVTGKEPTRRFSTIVVEEGHEGLTHFLMNEVIKLQQQMKAKDLQRCELLARLRQLEDEKKQMTLTRVELLTFQERY YKMKEERDSYNDELVKVKDDNYNLAMRYAQLSEEKNMAVMRSRDLQLEIDQLKHRLNKMEEECKLERNQSLKLKNDIENRPKKEQVLELE RENEMLKTKNQELQSIIQAGKRSLPDSDKAILDILEHDRKEALEDRQELVNRIYNLQEEARQAEELRDKYLEEKEDLELKCSTLGKDCEM YKHRMNTVMLQLEEVERERDQAFHSRDEAQTQYSQCLIEKDKYRKQIRELEEKNDEMRIEMVRREACIVNLESKLRRLSKDSNNLDQSLP RNLPVTIISQDFGDASPRTNGQEADDSSTSEESPEDSKYFLPYHPPQRRMNLKGIQLQRAKSPISLKRTSDFQGMDLSANQDEETDQETF QLEIDRDTKKCAFRTHTGKYWTLTATGGVQSTASSKNASCYFDIEWRDRRITLRASNGKFVTSKKNGQLAASVETAGDSELFLMKLINRP IIVFRGEHGFIGCRKVTGTLDANRSSYDVFQLEFNDGAYNIKDSTGKYWTVGSDSAVTSSGDTPVDFFFEFCDYNKVAIKVGGRYLKGDH -------------------------------------------------------------- >13023_13023_2_CARD11-FSCN1_CARD11_chr7_2972168_ENST00000396946_FSCN1_chr7_5642887_ENST00000382361_length(amino acids)=739AA_BP=523 MPGGGPEMDDYMETLKDEEDALWENVECNRHMLSRYINPAKLTPYLRQCKVIDEQDEDEVLNAPMLPSKINRAGRLLDILHTKGQRGYVV FLESLEFYYPELYKLVTGKEPTRRFSTIVVEEGHEGLTHFLMNEVIKLQQQMKAKDLQRCELLARLRQLEDEKKQMTLTRVELLTFQERY YKMKEERDSYNDELVKVKDDNYNLAMRYAQLSEEKNMAVMRSRDLQLEIDQLKHRLNKMEEECKLERNQSLKLKNDIENRPKKEQVLELE RENEMLKTKNQELQSIIQAGKRSLPDSDKAILDILEHDRKEALEDRQELVNRIYNLQEEARQAEELRDKYLEEKEDLELKCSTLGKDCEM YKHRMNTVMLQLEEVERERDQAFHSRDEAQTQYSQCLIEKDKYRKQIRELEEKNDEMRIEMVRREACIVNLESKLRRLSKDSNNLDQSLP RNLPVTIISQDFGDASPRTNGQEADDSSTSEESPEDSKYFLPYHPPQRRMNLKGIQLQRAKSPISLKRTSDFQGMDLSANQDEETDQETF QLEIDRDTKKCAFRTHTGKYWTLTATGGVQSTASSKNASCYFDIEWRDRRITLRASNGKFVTSKKNGQLAASVETAGDSELFLMKLINRP IIVFRGEHGFIGCRKVTGTLDANRSSYDVFQLEFNDGAYNIKDSTGKYWTVGSDSAVTSSGDTPVDFFFEFCDYNKVAIKVGGRYLKGDH -------------------------------------------------------------- |
Top |
Fusion Protein Functional Features |
| Four levels of functional features of fusion genes Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr7:2972168/chr7:5642887) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
 |
| Main function of each fusion partner protein. (from UniProt) |
| Hgene | Tgene |
| CARD11 | FSCN1 |
| FUNCTION: Involved in the costimulatory signal essential for T-cell receptor (TCR)-mediated T-cell activation. Its binding to DPP4 induces T-cell proliferation and NF-kappa-B activation in a T-cell receptor/CD3-dependent manner. Activates NF-kappa-B via BCL10 and IKK. Stimulates the phosphorylation of BCL10. Also activates the TORC1 signaling pathway. {ECO:0000269|PubMed:11278692, ECO:0000269|PubMed:11356195, ECO:0000269|PubMed:12356734, ECO:0000269|PubMed:28628108}. | FUNCTION: Actin-binding protein that contains 2 major actin binding sites (PubMed:21685497, PubMed:23184945). Organizes filamentous actin into parallel bundles (PubMed:20393565, PubMed:21685497, PubMed:23184945). Plays a role in the organization of actin filament bundles and the formation of microspikes, membrane ruffles, and stress fibers (PubMed:22155786). Important for the formation of a diverse set of cell protrusions, such as filopodia, and for cell motility and migration (PubMed:20393565, PubMed:21685497, PubMed:23184945). Mediates reorganization of the actin cytoskeleton and axon growth cone collapse in response to NGF (PubMed:22155786). {ECO:0000269|PubMed:20137952, ECO:0000269|PubMed:20393565, ECO:0000269|PubMed:21685497, ECO:0000269|PubMed:22155786, ECO:0000269|PubMed:23184945, ECO:0000269|PubMed:9362073, ECO:0000269|PubMed:9571235}. |
| Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
| - Retained protein feature among the 13 regional features. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
| Hgene | CARD11 | chr7:2972168 | chr7:5642887 | ENST00000396946 | - | 11 | 25 | 130_449 | 523.3333333333334 | 1155.0 | Coiled coil | Ontology_term=ECO:0000255 |
| Hgene | CARD11 | chr7:2972168 | chr7:5642887 | ENST00000396946 | - | 11 | 25 | 18_110 | 523.3333333333334 | 1155.0 | Domain | CARD |
| - Not-retained protein feature among the 13 regional features. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
| Hgene | CARD11 | chr7:2972168 | chr7:5642887 | ENST00000396946 | - | 11 | 25 | 667_755 | 523.3333333333334 | 1155.0 | Domain | Note=PDZ |
| Hgene | CARD11 | chr7:2972168 | chr7:5642887 | ENST00000396946 | - | 11 | 25 | 973_1140 | 523.3333333333334 | 1155.0 | Domain | Note=Guanylate kinase-like |
Top |
Fusion Protein-Protein Interaction |
| Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in |
| Protein-protein interactors with each fusion partner protein in wild-type from validated records (BIOGRID-3.4.160) |
| Gene | PPI interactors |
| Protein-protein interactors based on sequence similarity (STRING) |
| Gene | STRING network |
| CARD11 | |
| FSCN1 |
| - Retained interactions in fusion protein (protein functional feature from UniProt). |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
| - Lost interactions due to fusion (protein functional feature from UniProt). |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
Related Drugs to CARD11-FSCN1 |
| Drugs used for this fusion-positive patient. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
| Hgene | Tgene | Drug | Source | PMID |
Top |
Related Diseases to CARD11-FSCN1 |
| Diseases that have this fusion gene. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
| Hgene | Tgene | Disease | Source | PMID |
| Diseases associated with fusion partners. (DisGeNet 4.0) |
| Partner | Gene | Disease ID | Disease name | # pubmeds | Source |
Copyright 2021-Present -The University of Texas Health Science Center at Houston (UTHealth)
Web File Viewing | Emergency Information |Campus Carry|Site Policies