| UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
|
|||||||
|
Fusion Protein:CHST11-TRAC |
Fusion Protein Summary |
 Fusion gene summary |
| Fusion partner gene information | Fusion gene name: CHST11-TRAC | FusionPDB ID: 16691 | FusionGDB2.0 ID: 16691 | Hgene | Tgene | Gene symbol | CHST11 | TRAC | Gene ID | 50515 | 9612 |
| Gene name | carbohydrate sulfotransferase 11 | nuclear receptor corepressor 2 | |
| Synonyms | C4ST|C4ST-1|C4ST1|HSA269537|OCBMD | CTG26|N-CoR2|SMAP270|SMRT|SMRTE|SMRTE-tau|TNRC14|TRAC|TRAC-1|TRAC1 | |
| Cytomap | 12q23.3 | 12q24.31 | |
| Type of gene | protein-coding | protein-coding | |
| Description | carbohydrate sulfotransferase 11C4S-1IgH/CHST11 fusioncarbohydrate (chondroitin 4) sulfotransferase 11chondroitin 4-O-sulfotransferase 1 | nuclear receptor corepressor 2CTG repeat protein 26T3 receptor-associating factorsilencing mediator for retinoid and thyroid hormone receptorsthyroid-, retinoic-acid-receptor-associated corepressor | |
| Modification date | 20200313 | 20200313 | |
| UniProtAcc | Q9NPF2 | TAAR6 | |
| Ensembl transtripts involved in fusion gene | ENST ids | ENST00000303694, ENST00000547956, ENST00000546689, ENST00000549260, ENST00000550711, | ENST00000478163, |
| Fusion gene scores for assessment (based on all fusion genes of FusionGDB 2.0) | * DoF score | 13 X 8 X 6=624 | 8 X 3 X 3=72 |
| # samples | 15 | 8 | |
| ** MAII score | log2(15/624*10)=-2.05658352836637 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | log2(8/72*10)=0.15200309344505 effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs). DoF>8 and MAII>0 | |
| Context (manual curation of fusion genes in FusionPDB) | PubMed: CHST11 [Title/Abstract] AND TRAC [Title/Abstract] AND fusion [Title/Abstract] | ||
| Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) | CHST11(104851307)-TRAC(23016447), # samples:1 | ||
| Anticipated loss of major functional domain due to fusion event. | |||
| * DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
| Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Partner | Gene | GO ID | GO term | PubMed ID |
| Hgene | CHST11 | GO:0030206 | chondroitin sulfate biosynthetic process | 11056388 |
| Fusion gene breakpoints across CHST11 (5'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
 |
| Fusion gene breakpoints across TRAC (3'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
 |
Top |
Fusion Gene Sample Information |
| Fusion gene information from FusionGDB2.0. |
| Fusion gene information from two resources (ChiTars 5.0 and ChimerDB 4.0) * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
| Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
| ChimerDB4 | STAD | TCGA-BR-A4IY-01A | CHST11 | chr12 | 104851307 | + | TRAC | chr14 | 23016447 | + |
Top |
Fusion ORF Analysis |
| Fusion information from ORFfinder translation from full-length transcript sequence from FusionPDB. |
| Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
| ENST00000547956 | CHST11 | chr12 | 104851307 | + | ENST00000478163 | TRAC | chr14 | 23016447 | + | 1536 | 562 | 15 | 986 | 323 |
| ENST00000303694 | CHST11 | chr12 | 104851307 | + | ENST00000478163 | TRAC | chr14 | 23016447 | + | 1531 | 557 | 10 | 981 | 323 |
| DeepORF prediction of the coding potential based on the fusion transcript sequence of in-frame fusion genes. DeepORF is a coding potential classifier based on convolutional neural network by comparing the real Ribo-seq data. If the no-coding score < 0.5 and coding score > 0.5, then the in-frame fusion transcript is predicted as being likely translated. |
| Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
| ENST00000547956 | ENST00000478163 | CHST11 | chr12 | 104851307 | + | TRAC | chr14 | 23016447 | + | 0.013570554 | 0.98642945 |
| ENST00000303694 | ENST00000478163 | CHST11 | chr12 | 104851307 | + | TRAC | chr14 | 23016447 | + | 0.014022476 | 0.98597753 |
Top |
Fusion Amino Acid Sequences |
| For individual full-length fusion transcript sequence from FusionPDB, we ran ORFfinder and chose the longest ORF among the all predicted ones. |
| >FusionGDB ID_FusionGDB isoform ID_FGname_Hgene_Hchr_Hbp_Henst_Tgene_Tchr_Tbp_Tenst_length(fusion AA) seq_BP >16691_16691_1_CHST11-TRAC_CHST11_chr12_104851307_ENST00000303694_TRAC_chr14_23016447_ENST00000478163_length(amino acids)=323AA_BP=182 MERNEVAFGEKGEGPSDSHSGQRSGSGGGTTITARTPAARPATRQRRPPAGSEEAAERRGGGAGARSQRVHASQHFQTNSGTFHTPARAG GSESGREATPILPLSLAQLCPAPPGLRSARRGPCSCAPGALPGHPGPRSQDKAMKPALLEVMRMNRICRMVLATCLGSFILVIFYFQSML HPDIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKTVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFF -------------------------------------------------------------- >16691_16691_2_CHST11-TRAC_CHST11_chr12_104851307_ENST00000547956_TRAC_chr14_23016447_ENST00000478163_length(amino acids)=323AA_BP=182 MERNEVAFGEKGEGPSDSHSGQRSGSGGGTTITARTPAARPATRQRRPPAGSEEAAERRGGGAGARSQRVHASQHFQTNSGTFHTPARAG GSESGREATPILPLSLAQLCPAPPGLRSARRGPCSCAPGALPGHPGPRSQDKAMKPALLEVMRMNRICRMVLATCLGSFILVIFYFQSML HPDIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKTVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFF -------------------------------------------------------------- |
Top |
Fusion Protein Functional Features |
| Four levels of functional features of fusion genes Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr12:104851307/chr14:23016447) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
 |
| Main function of each fusion partner protein. (from UniProt) |
| Hgene | Tgene |
| CHST11 | TRAC |
| FUNCTION: Catalyzes the transfer of sulfate to position 4 of the N-acetylgalactosamine (GalNAc) residue of chondroitin. Chondroitin sulfate constitutes the predominant proteoglycan present in cartilage and is distributed on the surfaces of many cells and extracellular matrices. Can also sulfate Gal residues in desulfated dermatan sulfate. Preferentially sulfates in GlcA->GalNAc unit than in IdoA->GalNAc unit. Does not form 4, 6-di-O-sulfated GalNAc when chondroitin sulfate C is used as an acceptor. | 345 |
| Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
| - Retained protein feature among the 13 regional features. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
| Hgene | CHST11 | chr12:104851307 | chr14:23016447 | ENST00000303694 | + | 1 | 3 | 1_16 | 39.333333333333336 | 353.0 | Topological domain | Cytoplasmic |
| Hgene | CHST11 | chr12:104851307 | chr14:23016447 | ENST00000303694 | + | 1 | 3 | 17_37 | 39.333333333333336 | 353.0 | Transmembrane | Helical%3B Signal-anchor for type II membrane protein |
| - Not-retained protein feature among the 13 regional features. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
| Hgene | CHST11 | chr12:104851307 | chr14:23016447 | ENST00000303694 | + | 1 | 3 | 124_130 | 39.333333333333336 | 353.0 | Nucleotide binding | PAPS |
| Hgene | CHST11 | chr12:104851307 | chr14:23016447 | ENST00000303694 | + | 1 | 3 | 186_194 | 39.333333333333336 | 353.0 | Nucleotide binding | PAPS |
| Hgene | CHST11 | chr12:104851307 | chr14:23016447 | ENST00000549260 | + | 1 | 3 | 124_130 | 0 | 348.0 | Nucleotide binding | PAPS |
| Hgene | CHST11 | chr12:104851307 | chr14:23016447 | ENST00000549260 | + | 1 | 3 | 186_194 | 0 | 348.0 | Nucleotide binding | PAPS |
| Hgene | CHST11 | chr12:104851307 | chr14:23016447 | ENST00000303694 | + | 1 | 3 | 38_352 | 39.333333333333336 | 353.0 | Topological domain | Lumenal |
| Hgene | CHST11 | chr12:104851307 | chr14:23016447 | ENST00000549260 | + | 1 | 3 | 1_16 | 0 | 348.0 | Topological domain | Cytoplasmic |
| Hgene | CHST11 | chr12:104851307 | chr14:23016447 | ENST00000549260 | + | 1 | 3 | 38_352 | 0 | 348.0 | Topological domain | Lumenal |
| Hgene | CHST11 | chr12:104851307 | chr14:23016447 | ENST00000549260 | + | 1 | 3 | 17_37 | 0 | 348.0 | Transmembrane | Helical%3B Signal-anchor for type II membrane protein |
Top |
Fusion Protein-Protein Interaction |
| Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in |
| Protein-protein interactors with each fusion partner protein in wild-type from validated records (BIOGRID-3.4.160) |
| Gene | PPI interactors |
| Protein-protein interactors based on sequence similarity (STRING) |
| Gene | STRING network |
| CHST11 | |
| TRAC |
| - Retained interactions in fusion protein (protein functional feature from UniProt). |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
| - Lost interactions due to fusion (protein functional feature from UniProt). |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
Related Drugs to CHST11-TRAC |
| Drugs used for this fusion-positive patient. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
| Hgene | Tgene | Drug | Source | PMID |
Top |
Related Diseases to CHST11-TRAC |
| Diseases that have this fusion gene. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
| Hgene | Tgene | Disease | Source | PMID |
| Diseases associated with fusion partners. (DisGeNet 4.0) |
| Partner | Gene | Disease ID | Disease name | # pubmeds | Source |
Copyright 2021-Present -The University of Texas Health Science Center at Houston (UTHealth)
Web File Viewing | Emergency Information |Campus Carry|Site Policies