UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
![]() |
|||||||
|
Fusion Protein:CLN3-C15orf32 |
Fusion Protein Summary |
![]() |
Fusion partner gene information | Fusion gene name: CLN3-C15orf32 | FusionPDB ID: 17230 | FusionGDB2.0 ID: 17230 | Hgene | Tgene | Gene symbol | CLN3 | C15orf32 | Gene ID | 1201 | 145858 |
Gene name | CLN3 lysosomal/endosomal transmembrane protein, battenin | chromosome 15 putative open reading frame 32 | |
Synonyms | BTN1|BTS|JNCL | - | |
Cytomap | 16p12.1 | 15q26.1 | |
Type of gene | protein-coding | ncRNA | |
Description | batteninCLN3, batteninbatten disease proteinceroid-lipofuscinosis, neuronal 3 | uncharacterized protein C15orf32 | |
Modification date | 20200328 | 20200313 | |
UniProtAcc | Q13286 | . | |
Ensembl transtripts involved in fusion gene | ENST ids | ENST00000333496, ENST00000354630, ENST00000355477, ENST00000357806, ENST00000357857, ENST00000359984, ENST00000360019, ENST00000395653, ENST00000535392, ENST00000565316, ENST00000567963, ENST00000568224, ENST00000569430, ENST00000357076, ENST00000567160, | ENST00000556865, ENST00000333334, |
Fusion gene scores for assessment (based on all fusion genes of FusionGDB 2.0) | * DoF score | 5 X 4 X 3=60 | 2 X 2 X 2=8 |
# samples | 5 | 2 | |
** MAII score | log2(5/60*10)=-0.263034405833794 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | log2(2/8*10)=1.32192809488736 | |
Context (manual curation of fusion genes in FusionPDB) | PubMed: CLN3 [Title/Abstract] AND C15orf32 [Title/Abstract] AND fusion [Title/Abstract] | ||
Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) | CLN3(28495327)-C15orf32(93043588), # samples:4 | ||
Anticipated loss of major functional domain due to fusion event. | CLN3-C15orf32 seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. CLN3-C15orf32 seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. CLN3-C15orf32 seems lost the major protein functional domain in Tgene partner, which is a essential gene due to the frame-shifted ORF. |
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
![]() |
Partner | Gene | GO ID | GO term | PubMed ID |
Hgene | CLN3 | GO:0015809 | arginine transport | 16251196 |
Hgene | CLN3 | GO:0035752 | lysosomal lumen pH elevation | 10924275 |
Hgene | CLN3 | GO:0042987 | amyloid precursor protein catabolic process | 10924275 |
![]() * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
![]() |
![]() * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
![]() |
Top |
Fusion Gene Sample Information |
![]() |
![]() * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
ChimerDB4 | HNSC | TCGA-CR-5247-01A | CLN3 | chr16 | 28495327 | - | C15orf32 | chr15 | 93043588 | + |
ChimerDB4 | HNSC | TCGA-CR-5247 | CLN3 | chr16 | 28495327 | - | C15orf32 | chr15 | 93043588 | + |
Top |
Fusion ORF Analysis |
![]() |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
ENST00000568224 | CLN3 | chr16 | 28495327 | - | ENST00000333334 | C15orf32 | chr15 | 93043588 | + | 1652 | 892 | 261 | 902 | 213 |
ENST00000535392 | CLN3 | chr16 | 28495327 | - | ENST00000333334 | C15orf32 | chr15 | 93043588 | + | 1652 | 892 | 261 | 902 | 213 |
ENST00000360019 | CLN3 | chr16 | 28495327 | - | ENST00000333334 | C15orf32 | chr15 | 93043588 | + | 1909 | 1149 | 359 | 1159 | 266 |
ENST00000333496 | CLN3 | chr16 | 28495327 | - | ENST00000333334 | C15orf32 | chr15 | 93043588 | + | 1577 | 817 | 99 | 827 | 242 |
ENST00000355477 | CLN3 | chr16 | 28495327 | - | ENST00000333334 | C15orf32 | chr15 | 93043588 | + | 1523 | 763 | 117 | 773 | 218 |
ENST00000354630 | CLN3 | chr16 | 28495327 | - | ENST00000333334 | C15orf32 | chr15 | 93043588 | + | 1667 | 907 | 117 | 917 | 266 |
ENST00000567963 | CLN3 | chr16 | 28495327 | - | ENST00000333334 | C15orf32 | chr15 | 93043588 | + | 1662 | 902 | 112 | 912 | 266 |
![]() |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
ENST00000568224 | ENST00000333334 | CLN3 | chr16 | 28495327 | - | C15orf32 | chr15 | 93043588 | + | 0.20264056 | 0.79735947 |
ENST00000535392 | ENST00000333334 | CLN3 | chr16 | 28495327 | - | C15orf32 | chr15 | 93043588 | + | 0.20264056 | 0.79735947 |
ENST00000360019 | ENST00000333334 | CLN3 | chr16 | 28495327 | - | C15orf32 | chr15 | 93043588 | + | 0.31304294 | 0.686957 |
ENST00000333496 | ENST00000333334 | CLN3 | chr16 | 28495327 | - | C15orf32 | chr15 | 93043588 | + | 0.36673626 | 0.63326377 |
ENST00000355477 | ENST00000333334 | CLN3 | chr16 | 28495327 | - | C15orf32 | chr15 | 93043588 | + | 0.20586935 | 0.7941307 |
ENST00000354630 | ENST00000333334 | CLN3 | chr16 | 28495327 | - | C15orf32 | chr15 | 93043588 | + | 0.30506158 | 0.69493836 |
ENST00000567963 | ENST00000333334 | CLN3 | chr16 | 28495327 | - | C15orf32 | chr15 | 93043588 | + | 0.315488 | 0.68451196 |
Top |
Fusion Amino Acid Sequences |
![]() |
>FusionGDB ID_FusionGDB isoform ID_FGname_Hgene_Hchr_Hbp_Henst_Tgene_Tchr_Tbp_Tenst_length(fusion AA) seq_BP >17230_17230_1_CLN3-C15orf32_CLN3_chr16_28495327_ENST00000333496_C15orf32_chr15_93043588_ENST00000333334_length(amino acids)=242AA_BP= MGGCAGSRRRFSDSEGEETVPEPRLPLLDHQGAHWKNAVGFWLLGLCNNFSYVVMLSAAHDILSHKRTSGNQSHAVLLADILPTLVIKLL APLGLHLLPYSPRVLVSGICAAGSFVLVAFSHSVGTSLCGVVFASISSGLGEVTFLSLTAFYPRAVISWWSSGTGGAGLLGALSYLGLTQ -------------------------------------------------------------- >17230_17230_2_CLN3-C15orf32_CLN3_chr16_28495327_ENST00000354630_C15orf32_chr15_93043588_ENST00000333334_length(amino acids)=266AA_BP= MGGCAGSRRRFSDSEGEETVPEPRLPLLDHQGAHWKNAVGFWLLGLCNNFSYVVMLSAAHDILSHKRTSGNQSHVDPGPTPIPHNSSSRF DCNSVSTAAVLLADILPTLVIKLLAPLGLHLLPYSPRVLVSGICAAGSFVLVAFSHSVGTSLCGVVFASISSGLGEVTFLSLTAFYPRAV -------------------------------------------------------------- >17230_17230_3_CLN3-C15orf32_CLN3_chr16_28495327_ENST00000355477_C15orf32_chr15_93043588_ENST00000333334_length(amino acids)=218AA_BP= MGGCAGSRRRFSDSEGEETVPEPRLPLLDHQGAHWKNAVGFWLLGLCNNFSYVVMLSAAHDILSHKRTSGNQSHVDPGPTPIPHNSSSRF DCNSVSTAAVLLADILPTLVIKLLAPLGLHLLPYSPRVLVSGICAAGSFVLVAFSHSVGTSLCGVVFASISSGLGEVTFLSLTAFYPSYF -------------------------------------------------------------- >17230_17230_4_CLN3-C15orf32_CLN3_chr16_28495327_ENST00000360019_C15orf32_chr15_93043588_ENST00000333334_length(amino acids)=266AA_BP= MGGCAGSRRRFSDSEGEETVPEPRLPLLDHQGAHWKNAVGFWLLGLCNNFSYVVMLSAAHDILSHKRTSGNQSHVDPGPTPIPHNSSSRF DCNSVSTAAVLLADILPTLVIKLLAPLGLHLLPYSPRVLVSGICAAGSFVLVAFSHSVGTSLCGVVFASISSGLGEVTFLSLTAFYPRAV -------------------------------------------------------------- >17230_17230_5_CLN3-C15orf32_CLN3_chr16_28495327_ENST00000535392_C15orf32_chr15_93043588_ENST00000333334_length(amino acids)=213AA_BP= MCRLAAALFGFRGLLGLCNNFSYVVMLSAAHDILSHKRTSGNQSHAVLLADILPTLVIKLLAPLGLHLLPYSPRVLVSGICAAGSFVLVA FSHSVGTSLCGVVFASISSGLGEVTFLSLTAFYPRAVISWWSSGTGGAGLLGALSYLGLTQAGLSPQQTLLSMLGIPALLLASYFLLLTS -------------------------------------------------------------- >17230_17230_6_CLN3-C15orf32_CLN3_chr16_28495327_ENST00000567963_C15orf32_chr15_93043588_ENST00000333334_length(amino acids)=266AA_BP= MGGCAGSRRRFSDSEGEETVPEPRLPLLDHQGAHWKNAVGFWLLGLCNNFSYVVMLSAAHDILSHKRTSGNQSHVDPGPTPIPHNSSSRF DCNSVSTAAVLLADILPTLVIKLLAPLGLHLLPYSPRVLVSGICAAGSFVLVAFSHSVGTSLCGVVFASISSGLGEVTFLSLTAFYPRAV -------------------------------------------------------------- >17230_17230_7_CLN3-C15orf32_CLN3_chr16_28495327_ENST00000568224_C15orf32_chr15_93043588_ENST00000333334_length(amino acids)=213AA_BP= MCRLAAALFGFRGLLGLCNNFSYVVMLSAAHDILSHKRTSGNQSHAVLLADILPTLVIKLLAPLGLHLLPYSPRVLVSGICAAGSFVLVA FSHSVGTSLCGVVFASISSGLGEVTFLSLTAFYPRAVISWWSSGTGGAGLLGALSYLGLTQAGLSPQQTLLSMLGIPALLLASYFLLLTS -------------------------------------------------------------- |
Top |
Fusion Protein Functional Features |
![]() Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr16:28495327/chr15:93043588) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
![]() |
![]() |
Hgene | Tgene |
CLN3 | . |
FUNCTION: Mediates microtubule-dependent, anterograde transport connecting the Golgi network, endosomes, autophagosomes, lysosomes and plasma membrane, and participates in several cellular processes such as regulation of lysosomal pH, lysosome protein degradation, receptor-mediated endocytosis, autophagy, transport of proteins and lipids from the TGN, apoptosis and synaptic transmission (PubMed:10924275, PubMed:18817525, PubMed:18317235, PubMed:22261744, PubMed:15471887, PubMed:20850431). Facilitates the proteins transport from trans-Golgi network (TGN)-to other membrane compartments such as transport of microdomain-associated proteins to the plasma membrane, IGF2R transport to the lysosome where it regulates the CTSD release leading to regulation of CTSD maturation and thereby APP intracellular processing (PubMed:10924275, PubMed:18817525). Moreover regulates CTSD activity in response to osmotic stress (PubMed:23840424, PubMed:28390177). Also binds galactosylceramide and transports it from the trans Golgi to the rafts, which may have immediate and downstream effects on cell survival by modulating ceramide synthesis (PubMed:18317235). At the plasma membrane, regulates actin-dependent events including filopodia formation, cell migration, and pinocytosis through ARF1-CDC42 pathway and also the cytoskeleton organization through interaction with MYH10 and fodrin leading to the regulation of the plasma membrane association of Na+, K+ ATPase complex (PubMed:20850431). Regulates synaptic transmission in the amygdala, hippocampus, and cerebellum through regulation of synaptic vesicles density and their proximity to active zones leading to modulation of short-term plasticity and age-dependent anxious behavior, learning and memory (By similarity). Regulates autophagic vacuoles (AVs) maturation by modulating the trafficking between endocytic and autophagolysosomal/lysosomal compartments, which involves vesicle fusion leading to regulation of degradation process (By similarity). Participates also in cellular homeostasis of compounds such as, water, ions, amino acids, proteins and lipids in several tissue namely in brain and kidney through regulation of their transport and synthesis (PubMed:17482562). {ECO:0000250|UniProtKB:Q61124, ECO:0000269|PubMed:10924275, ECO:0000269|PubMed:15471887, ECO:0000269|PubMed:17482562, ECO:0000269|PubMed:18317235, ECO:0000269|PubMed:18817525, ECO:0000269|PubMed:20850431, ECO:0000269|PubMed:22261744, ECO:0000269|PubMed:23840424, ECO:0000269|PubMed:28390177}. | FUNCTION: Might normally function as a transcriptional repressor. EWS-fusion-proteins (EFPS) may play a role in the tumorigenic process. They may disturb gene expression by mimicking, or interfering with the normal function of CTD-POLII within the transcription initiation complex. They may also contribute to an aberrant activation of the fusion protein target genes. |
![]() |
- Retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Hgene | CLN3 | chr16:28495327 | chr15:93043588 | ENST00000354630 | - | 10 | 15 | 149_151 | 263.3333333333333 | 422.0 | Topological domain | Cytoplasmic |
Hgene | CLN3 | chr16:28495327 | chr15:93043588 | ENST00000354630 | - | 10 | 15 | 173_182 | 263.3333333333333 | 422.0 | Topological domain | Lumenal |
Hgene | CLN3 | chr16:28495327 | chr15:93043588 | ENST00000354630 | - | 10 | 15 | 1_37 | 263.3333333333333 | 422.0 | Topological domain | Cytoplasmic |
Hgene | CLN3 | chr16:28495327 | chr15:93043588 | ENST00000354630 | - | 10 | 15 | 59_127 | 263.3333333333333 | 422.0 | Topological domain | Lumenal |
Hgene | CLN3 | chr16:28495327 | chr15:93043588 | ENST00000355477 | - | 9 | 15 | 149_151 | 215.33333333333334 | 391.0 | Topological domain | Cytoplasmic |
Hgene | CLN3 | chr16:28495327 | chr15:93043588 | ENST00000355477 | - | 9 | 15 | 173_182 | 215.33333333333334 | 391.0 | Topological domain | Lumenal |
Hgene | CLN3 | chr16:28495327 | chr15:93043588 | ENST00000355477 | - | 9 | 15 | 1_37 | 215.33333333333334 | 391.0 | Topological domain | Cytoplasmic |
Hgene | CLN3 | chr16:28495327 | chr15:93043588 | ENST00000355477 | - | 9 | 15 | 59_127 | 215.33333333333334 | 391.0 | Topological domain | Lumenal |
Hgene | CLN3 | chr16:28495327 | chr15:93043588 | ENST00000357806 | - | 6 | 12 | 149_151 | 164.33333333333334 | 340.0 | Topological domain | Cytoplasmic |
Hgene | CLN3 | chr16:28495327 | chr15:93043588 | ENST00000357806 | - | 6 | 12 | 1_37 | 164.33333333333334 | 340.0 | Topological domain | Cytoplasmic |
Hgene | CLN3 | chr16:28495327 | chr15:93043588 | ENST00000357806 | - | 6 | 12 | 59_127 | 164.33333333333334 | 340.0 | Topological domain | Lumenal |
Hgene | CLN3 | chr16:28495327 | chr15:93043588 | ENST00000359984 | - | 9 | 15 | 149_151 | 263.3333333333333 | 439.0 | Topological domain | Cytoplasmic |
Hgene | CLN3 | chr16:28495327 | chr15:93043588 | ENST00000359984 | - | 9 | 15 | 173_182 | 263.3333333333333 | 439.0 | Topological domain | Lumenal |
Hgene | CLN3 | chr16:28495327 | chr15:93043588 | ENST00000359984 | - | 9 | 15 | 1_37 | 263.3333333333333 | 439.0 | Topological domain | Cytoplasmic |
Hgene | CLN3 | chr16:28495327 | chr15:93043588 | ENST00000359984 | - | 9 | 15 | 59_127 | 263.3333333333333 | 439.0 | Topological domain | Lumenal |
Hgene | CLN3 | chr16:28495327 | chr15:93043588 | ENST00000360019 | - | 10 | 16 | 149_151 | 263.3333333333333 | 439.0 | Topological domain | Cytoplasmic |
Hgene | CLN3 | chr16:28495327 | chr15:93043588 | ENST00000360019 | - | 10 | 16 | 173_182 | 263.3333333333333 | 439.0 | Topological domain | Lumenal |
Hgene | CLN3 | chr16:28495327 | chr15:93043588 | ENST00000360019 | - | 10 | 16 | 1_37 | 263.3333333333333 | 439.0 | Topological domain | Cytoplasmic |
Hgene | CLN3 | chr16:28495327 | chr15:93043588 | ENST00000360019 | - | 10 | 16 | 59_127 | 263.3333333333333 | 439.0 | Topological domain | Lumenal |
Hgene | CLN3 | chr16:28495327 | chr15:93043588 | ENST00000565316 | - | 9 | 14 | 149_151 | 263.3333333333333 | 422.0 | Topological domain | Cytoplasmic |
Hgene | CLN3 | chr16:28495327 | chr15:93043588 | ENST00000565316 | - | 9 | 14 | 173_182 | 263.3333333333333 | 422.0 | Topological domain | Lumenal |
Hgene | CLN3 | chr16:28495327 | chr15:93043588 | ENST00000565316 | - | 9 | 14 | 1_37 | 263.3333333333333 | 422.0 | Topological domain | Cytoplasmic |
Hgene | CLN3 | chr16:28495327 | chr15:93043588 | ENST00000565316 | - | 9 | 14 | 59_127 | 263.3333333333333 | 422.0 | Topological domain | Lumenal |
Hgene | CLN3 | chr16:28495327 | chr15:93043588 | ENST00000569430 | - | 11 | 17 | 149_151 | 263.3333333333333 | 439.0 | Topological domain | Cytoplasmic |
Hgene | CLN3 | chr16:28495327 | chr15:93043588 | ENST00000569430 | - | 11 | 17 | 173_182 | 263.3333333333333 | 439.0 | Topological domain | Lumenal |
Hgene | CLN3 | chr16:28495327 | chr15:93043588 | ENST00000569430 | - | 11 | 17 | 1_37 | 263.3333333333333 | 439.0 | Topological domain | Cytoplasmic |
Hgene | CLN3 | chr16:28495327 | chr15:93043588 | ENST00000569430 | - | 11 | 17 | 59_127 | 263.3333333333333 | 439.0 | Topological domain | Lumenal |
Hgene | CLN3 | chr16:28495327 | chr15:93043588 | ENST00000354630 | - | 10 | 15 | 128_148 | 263.3333333333333 | 422.0 | Transmembrane | Helical |
Hgene | CLN3 | chr16:28495327 | chr15:93043588 | ENST00000354630 | - | 10 | 15 | 152_172 | 263.3333333333333 | 422.0 | Transmembrane | Helical |
Hgene | CLN3 | chr16:28495327 | chr15:93043588 | ENST00000354630 | - | 10 | 15 | 183_203 | 263.3333333333333 | 422.0 | Transmembrane | Helical |
Hgene | CLN3 | chr16:28495327 | chr15:93043588 | ENST00000354630 | - | 10 | 15 | 38_58 | 263.3333333333333 | 422.0 | Transmembrane | Helical |
Hgene | CLN3 | chr16:28495327 | chr15:93043588 | ENST00000355477 | - | 9 | 15 | 128_148 | 215.33333333333334 | 391.0 | Transmembrane | Helical |
Hgene | CLN3 | chr16:28495327 | chr15:93043588 | ENST00000355477 | - | 9 | 15 | 152_172 | 215.33333333333334 | 391.0 | Transmembrane | Helical |
Hgene | CLN3 | chr16:28495327 | chr15:93043588 | ENST00000355477 | - | 9 | 15 | 183_203 | 215.33333333333334 | 391.0 | Transmembrane | Helical |
Hgene | CLN3 | chr16:28495327 | chr15:93043588 | ENST00000355477 | - | 9 | 15 | 38_58 | 215.33333333333334 | 391.0 | Transmembrane | Helical |
Hgene | CLN3 | chr16:28495327 | chr15:93043588 | ENST00000357806 | - | 6 | 12 | 128_148 | 164.33333333333334 | 340.0 | Transmembrane | Helical |
Hgene | CLN3 | chr16:28495327 | chr15:93043588 | ENST00000357806 | - | 6 | 12 | 38_58 | 164.33333333333334 | 340.0 | Transmembrane | Helical |
Hgene | CLN3 | chr16:28495327 | chr15:93043588 | ENST00000359984 | - | 9 | 15 | 128_148 | 263.3333333333333 | 439.0 | Transmembrane | Helical |
Hgene | CLN3 | chr16:28495327 | chr15:93043588 | ENST00000359984 | - | 9 | 15 | 152_172 | 263.3333333333333 | 439.0 | Transmembrane | Helical |
Hgene | CLN3 | chr16:28495327 | chr15:93043588 | ENST00000359984 | - | 9 | 15 | 183_203 | 263.3333333333333 | 439.0 | Transmembrane | Helical |
Hgene | CLN3 | chr16:28495327 | chr15:93043588 | ENST00000359984 | - | 9 | 15 | 38_58 | 263.3333333333333 | 439.0 | Transmembrane | Helical |
Hgene | CLN3 | chr16:28495327 | chr15:93043588 | ENST00000360019 | - | 10 | 16 | 128_148 | 263.3333333333333 | 439.0 | Transmembrane | Helical |
Hgene | CLN3 | chr16:28495327 | chr15:93043588 | ENST00000360019 | - | 10 | 16 | 152_172 | 263.3333333333333 | 439.0 | Transmembrane | Helical |
Hgene | CLN3 | chr16:28495327 | chr15:93043588 | ENST00000360019 | - | 10 | 16 | 183_203 | 263.3333333333333 | 439.0 | Transmembrane | Helical |
Hgene | CLN3 | chr16:28495327 | chr15:93043588 | ENST00000360019 | - | 10 | 16 | 38_58 | 263.3333333333333 | 439.0 | Transmembrane | Helical |
Hgene | CLN3 | chr16:28495327 | chr15:93043588 | ENST00000565316 | - | 9 | 14 | 128_148 | 263.3333333333333 | 422.0 | Transmembrane | Helical |
Hgene | CLN3 | chr16:28495327 | chr15:93043588 | ENST00000565316 | - | 9 | 14 | 152_172 | 263.3333333333333 | 422.0 | Transmembrane | Helical |
Hgene | CLN3 | chr16:28495327 | chr15:93043588 | ENST00000565316 | - | 9 | 14 | 183_203 | 263.3333333333333 | 422.0 | Transmembrane | Helical |
Hgene | CLN3 | chr16:28495327 | chr15:93043588 | ENST00000565316 | - | 9 | 14 | 38_58 | 263.3333333333333 | 422.0 | Transmembrane | Helical |
Hgene | CLN3 | chr16:28495327 | chr15:93043588 | ENST00000569430 | - | 11 | 17 | 128_148 | 263.3333333333333 | 439.0 | Transmembrane | Helical |
Hgene | CLN3 | chr16:28495327 | chr15:93043588 | ENST00000569430 | - | 11 | 17 | 152_172 | 263.3333333333333 | 439.0 | Transmembrane | Helical |
Hgene | CLN3 | chr16:28495327 | chr15:93043588 | ENST00000569430 | - | 11 | 17 | 183_203 | 263.3333333333333 | 439.0 | Transmembrane | Helical |
Hgene | CLN3 | chr16:28495327 | chr15:93043588 | ENST00000569430 | - | 11 | 17 | 38_58 | 263.3333333333333 | 439.0 | Transmembrane | Helical |
- Not-retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Hgene | CLN3 | chr16:28495327 | chr15:93043588 | ENST00000354630 | - | 10 | 15 | 409_419 | 263.3333333333333 | 422.0 | Motif | Lysosomal targeting motif |
Hgene | CLN3 | chr16:28495327 | chr15:93043588 | ENST00000355477 | - | 9 | 15 | 409_419 | 215.33333333333334 | 391.0 | Motif | Lysosomal targeting motif |
Hgene | CLN3 | chr16:28495327 | chr15:93043588 | ENST00000357076 | - | 1 | 12 | 409_419 | 0 | 254.0 | Motif | Lysosomal targeting motif |
Hgene | CLN3 | chr16:28495327 | chr15:93043588 | ENST00000357806 | - | 6 | 12 | 409_419 | 164.33333333333334 | 340.0 | Motif | Lysosomal targeting motif |
Hgene | CLN3 | chr16:28495327 | chr15:93043588 | ENST00000359984 | - | 9 | 15 | 409_419 | 263.3333333333333 | 439.0 | Motif | Lysosomal targeting motif |
Hgene | CLN3 | chr16:28495327 | chr15:93043588 | ENST00000360019 | - | 10 | 16 | 409_419 | 263.3333333333333 | 439.0 | Motif | Lysosomal targeting motif |
Hgene | CLN3 | chr16:28495327 | chr15:93043588 | ENST00000565316 | - | 9 | 14 | 409_419 | 263.3333333333333 | 422.0 | Motif | Lysosomal targeting motif |
Hgene | CLN3 | chr16:28495327 | chr15:93043588 | ENST00000569430 | - | 11 | 17 | 409_419 | 263.3333333333333 | 439.0 | Motif | Lysosomal targeting motif |
Hgene | CLN3 | chr16:28495327 | chr15:93043588 | ENST00000354630 | - | 10 | 15 | 204_277 | 263.3333333333333 | 422.0 | Topological domain | Cytoplasmic |
Hgene | CLN3 | chr16:28495327 | chr15:93043588 | ENST00000354630 | - | 10 | 15 | 299_346 | 263.3333333333333 | 422.0 | Topological domain | Lumenal |
Hgene | CLN3 | chr16:28495327 | chr15:93043588 | ENST00000354630 | - | 10 | 15 | 368_438 | 263.3333333333333 | 422.0 | Topological domain | Cytoplasmic |
Hgene | CLN3 | chr16:28495327 | chr15:93043588 | ENST00000355477 | - | 9 | 15 | 204_277 | 215.33333333333334 | 391.0 | Topological domain | Cytoplasmic |
Hgene | CLN3 | chr16:28495327 | chr15:93043588 | ENST00000355477 | - | 9 | 15 | 299_346 | 215.33333333333334 | 391.0 | Topological domain | Lumenal |
Hgene | CLN3 | chr16:28495327 | chr15:93043588 | ENST00000355477 | - | 9 | 15 | 368_438 | 215.33333333333334 | 391.0 | Topological domain | Cytoplasmic |
Hgene | CLN3 | chr16:28495327 | chr15:93043588 | ENST00000357076 | - | 1 | 12 | 149_151 | 0 | 254.0 | Topological domain | Cytoplasmic |
Hgene | CLN3 | chr16:28495327 | chr15:93043588 | ENST00000357076 | - | 1 | 12 | 173_182 | 0 | 254.0 | Topological domain | Lumenal |
Hgene | CLN3 | chr16:28495327 | chr15:93043588 | ENST00000357076 | - | 1 | 12 | 1_37 | 0 | 254.0 | Topological domain | Cytoplasmic |
Hgene | CLN3 | chr16:28495327 | chr15:93043588 | ENST00000357076 | - | 1 | 12 | 204_277 | 0 | 254.0 | Topological domain | Cytoplasmic |
Hgene | CLN3 | chr16:28495327 | chr15:93043588 | ENST00000357076 | - | 1 | 12 | 299_346 | 0 | 254.0 | Topological domain | Lumenal |
Hgene | CLN3 | chr16:28495327 | chr15:93043588 | ENST00000357076 | - | 1 | 12 | 368_438 | 0 | 254.0 | Topological domain | Cytoplasmic |
Hgene | CLN3 | chr16:28495327 | chr15:93043588 | ENST00000357076 | - | 1 | 12 | 59_127 | 0 | 254.0 | Topological domain | Lumenal |
Hgene | CLN3 | chr16:28495327 | chr15:93043588 | ENST00000357806 | - | 6 | 12 | 173_182 | 164.33333333333334 | 340.0 | Topological domain | Lumenal |
Hgene | CLN3 | chr16:28495327 | chr15:93043588 | ENST00000357806 | - | 6 | 12 | 204_277 | 164.33333333333334 | 340.0 | Topological domain | Cytoplasmic |
Hgene | CLN3 | chr16:28495327 | chr15:93043588 | ENST00000357806 | - | 6 | 12 | 299_346 | 164.33333333333334 | 340.0 | Topological domain | Lumenal |
Hgene | CLN3 | chr16:28495327 | chr15:93043588 | ENST00000357806 | - | 6 | 12 | 368_438 | 164.33333333333334 | 340.0 | Topological domain | Cytoplasmic |
Hgene | CLN3 | chr16:28495327 | chr15:93043588 | ENST00000359984 | - | 9 | 15 | 204_277 | 263.3333333333333 | 439.0 | Topological domain | Cytoplasmic |
Hgene | CLN3 | chr16:28495327 | chr15:93043588 | ENST00000359984 | - | 9 | 15 | 299_346 | 263.3333333333333 | 439.0 | Topological domain | Lumenal |
Hgene | CLN3 | chr16:28495327 | chr15:93043588 | ENST00000359984 | - | 9 | 15 | 368_438 | 263.3333333333333 | 439.0 | Topological domain | Cytoplasmic |
Hgene | CLN3 | chr16:28495327 | chr15:93043588 | ENST00000360019 | - | 10 | 16 | 204_277 | 263.3333333333333 | 439.0 | Topological domain | Cytoplasmic |
Hgene | CLN3 | chr16:28495327 | chr15:93043588 | ENST00000360019 | - | 10 | 16 | 299_346 | 263.3333333333333 | 439.0 | Topological domain | Lumenal |
Hgene | CLN3 | chr16:28495327 | chr15:93043588 | ENST00000360019 | - | 10 | 16 | 368_438 | 263.3333333333333 | 439.0 | Topological domain | Cytoplasmic |
Hgene | CLN3 | chr16:28495327 | chr15:93043588 | ENST00000565316 | - | 9 | 14 | 204_277 | 263.3333333333333 | 422.0 | Topological domain | Cytoplasmic |
Hgene | CLN3 | chr16:28495327 | chr15:93043588 | ENST00000565316 | - | 9 | 14 | 299_346 | 263.3333333333333 | 422.0 | Topological domain | Lumenal |
Hgene | CLN3 | chr16:28495327 | chr15:93043588 | ENST00000565316 | - | 9 | 14 | 368_438 | 263.3333333333333 | 422.0 | Topological domain | Cytoplasmic |
Hgene | CLN3 | chr16:28495327 | chr15:93043588 | ENST00000569430 | - | 11 | 17 | 204_277 | 263.3333333333333 | 439.0 | Topological domain | Cytoplasmic |
Hgene | CLN3 | chr16:28495327 | chr15:93043588 | ENST00000569430 | - | 11 | 17 | 299_346 | 263.3333333333333 | 439.0 | Topological domain | Lumenal |
Hgene | CLN3 | chr16:28495327 | chr15:93043588 | ENST00000569430 | - | 11 | 17 | 368_438 | 263.3333333333333 | 439.0 | Topological domain | Cytoplasmic |
Hgene | CLN3 | chr16:28495327 | chr15:93043588 | ENST00000354630 | - | 10 | 15 | 278_298 | 263.3333333333333 | 422.0 | Transmembrane | Helical |
Hgene | CLN3 | chr16:28495327 | chr15:93043588 | ENST00000354630 | - | 10 | 15 | 347_367 | 263.3333333333333 | 422.0 | Transmembrane | Helical |
Hgene | CLN3 | chr16:28495327 | chr15:93043588 | ENST00000355477 | - | 9 | 15 | 278_298 | 215.33333333333334 | 391.0 | Transmembrane | Helical |
Hgene | CLN3 | chr16:28495327 | chr15:93043588 | ENST00000355477 | - | 9 | 15 | 347_367 | 215.33333333333334 | 391.0 | Transmembrane | Helical |
Hgene | CLN3 | chr16:28495327 | chr15:93043588 | ENST00000357076 | - | 1 | 12 | 128_148 | 0 | 254.0 | Transmembrane | Helical |
Hgene | CLN3 | chr16:28495327 | chr15:93043588 | ENST00000357076 | - | 1 | 12 | 152_172 | 0 | 254.0 | Transmembrane | Helical |
Hgene | CLN3 | chr16:28495327 | chr15:93043588 | ENST00000357076 | - | 1 | 12 | 183_203 | 0 | 254.0 | Transmembrane | Helical |
Hgene | CLN3 | chr16:28495327 | chr15:93043588 | ENST00000357076 | - | 1 | 12 | 278_298 | 0 | 254.0 | Transmembrane | Helical |
Hgene | CLN3 | chr16:28495327 | chr15:93043588 | ENST00000357076 | - | 1 | 12 | 347_367 | 0 | 254.0 | Transmembrane | Helical |
Hgene | CLN3 | chr16:28495327 | chr15:93043588 | ENST00000357076 | - | 1 | 12 | 38_58 | 0 | 254.0 | Transmembrane | Helical |
Hgene | CLN3 | chr16:28495327 | chr15:93043588 | ENST00000357806 | - | 6 | 12 | 152_172 | 164.33333333333334 | 340.0 | Transmembrane | Helical |
Hgene | CLN3 | chr16:28495327 | chr15:93043588 | ENST00000357806 | - | 6 | 12 | 183_203 | 164.33333333333334 | 340.0 | Transmembrane | Helical |
Hgene | CLN3 | chr16:28495327 | chr15:93043588 | ENST00000357806 | - | 6 | 12 | 278_298 | 164.33333333333334 | 340.0 | Transmembrane | Helical |
Hgene | CLN3 | chr16:28495327 | chr15:93043588 | ENST00000357806 | - | 6 | 12 | 347_367 | 164.33333333333334 | 340.0 | Transmembrane | Helical |
Hgene | CLN3 | chr16:28495327 | chr15:93043588 | ENST00000359984 | - | 9 | 15 | 278_298 | 263.3333333333333 | 439.0 | Transmembrane | Helical |
Hgene | CLN3 | chr16:28495327 | chr15:93043588 | ENST00000359984 | - | 9 | 15 | 347_367 | 263.3333333333333 | 439.0 | Transmembrane | Helical |
Hgene | CLN3 | chr16:28495327 | chr15:93043588 | ENST00000360019 | - | 10 | 16 | 278_298 | 263.3333333333333 | 439.0 | Transmembrane | Helical |
Hgene | CLN3 | chr16:28495327 | chr15:93043588 | ENST00000360019 | - | 10 | 16 | 347_367 | 263.3333333333333 | 439.0 | Transmembrane | Helical |
Hgene | CLN3 | chr16:28495327 | chr15:93043588 | ENST00000565316 | - | 9 | 14 | 278_298 | 263.3333333333333 | 422.0 | Transmembrane | Helical |
Hgene | CLN3 | chr16:28495327 | chr15:93043588 | ENST00000565316 | - | 9 | 14 | 347_367 | 263.3333333333333 | 422.0 | Transmembrane | Helical |
Hgene | CLN3 | chr16:28495327 | chr15:93043588 | ENST00000569430 | - | 11 | 17 | 278_298 | 263.3333333333333 | 439.0 | Transmembrane | Helical |
Hgene | CLN3 | chr16:28495327 | chr15:93043588 | ENST00000569430 | - | 11 | 17 | 347_367 | 263.3333333333333 | 439.0 | Transmembrane | Helical |
Top |
Fusion Protein Structures |
![]() * Here we show the 3D structure of the fusion proteins using Mol*. AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Model confidence is shown from the pLDDT values per residue. pLDDT corresponds to the model’s prediction of its score on the local Distance Difference Test. It is a measure of local accuracy (from AlphfaFold website). To color code individual residues, we transformed individual PDB files into CIF format. |
Fusion protein PDB link (fusion AA seq ID in FusionPDB) | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | AA seq | Len(AA seq) |
PDB file >>>453_CLN3_28495327_C15orf32_93043588_ranked_0.pdb | CLN3 | 28495327 | 28495327 | ENST00000333334 | C15orf32 | chr15 | 93043588 | + | MGGCAGSRRRFSDSEGEETVPEPRLPLLDHQGAHWKNAVGFWLLGLCNNFSYVVMLSAAHDILSHKRTSGNQSHVDPGPTPIPHNSSSRF DCNSVSTAAVLLADILPTLVIKLLAPLGLHLLPYSPRVLVSGICAAGSFVLVAFSHSVGTSLCGVVFASISSGLGEVTFLSLTAFYPRAV | 266 |
Top |
pLDDT score distribution |
![]() * AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. |
CLN3_pLDDT.png![]() |
C15orf32_pLDDT.png![]() |
![]() * AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. |
![]() |
Top |
Ramachandran Plot of Fusion Protein Structure |
![]() |
Fusion AA seq ID in FusionPDB and their Ramachandran plots |
Top |
Fusion Protein-Protein Interaction |
![]() |
![]() |
Gene | PPI interactors |
![]() |
Gene | STRING network |
CLN3 | |
C15orf32 |
![]() |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
![]() |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
Related Drugs to CLN3-C15orf32 |
![]() (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Drug | Source | PMID |
Top |
Related Diseases to CLN3-C15orf32 |
![]() (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Disease | Source | PMID |
![]() (DisGeNet 4.0) |
Partner | Gene | Disease ID | Disease name | # pubmeds | Source |