UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
![]() |
|||||||
|
Fusion Protein:CSNK1D-POLR2E |
Fusion Protein Summary |
![]() |
Fusion partner gene information | Fusion gene name: CSNK1D-POLR2E | FusionPDB ID: 19821 | FusionGDB2.0 ID: 19821 | Hgene | Tgene | Gene symbol | CSNK1D | POLR2E | Gene ID | 1453 | 5434 |
Gene name | casein kinase 1 delta | RNA polymerase II subunit E | |
Synonyms | ASPS|CKI-delta|CKId|CKIdelta|FASPS2|HCKID | RPABC1|RPB5|XAP4|hRPB25|hsRPB5 | |
Cytomap | 17q25.3 | 19p13.3 | |
Type of gene | protein-coding | protein-coding | |
Description | casein kinase I isoform deltacasein kinase Itau-protein kinase CSNK1D | DNA-directed RNA polymerases I, II, and III subunit RPABC1DNA directed RNA polymerase II 23 kda polypeptideDNA-directed RNA polymerase II 23 kDa polypeptideDNA-directed RNA polymerase II subunit EDNA-directed RNA polymerase subunit RPABC1RNA polymera | |
Modification date | 20200313 | 20200313 | |
UniProtAcc | P48730 | . | |
Ensembl transtripts involved in fusion gene | ENST ids | ENST00000314028, ENST00000392334, ENST00000398519, ENST00000578904, | ENST00000585838, ENST00000215587, ENST00000586746, |
Fusion gene scores for assessment (based on all fusion genes of FusionGDB 2.0) | * DoF score | 17 X 16 X 13=3536 | 6 X 6 X 4=144 |
# samples | 24 | 8 | |
** MAII score | log2(24/3536*10)=-3.88101196378291 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | log2(8/144*10)=-0.84799690655495 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | |
Context (manual curation of fusion genes in FusionPDB) | PubMed: CSNK1D [Title/Abstract] AND POLR2E [Title/Abstract] AND fusion [Title/Abstract] | ||
Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) | CSNK1D(80223561)-POLR2E(1090987), # samples:1 CSNK1D(80223562)-POLR2E(1090144), # samples:1 CSNK1D(80223562)-POLR2E(1090987), # samples:1 CSNK1D(80223562)-POLR2E(1089550), # samples:1 | ||
Anticipated loss of major functional domain due to fusion event. | CSNK1D-POLR2E seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. CSNK1D-POLR2E seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. CSNK1D-POLR2E seems lost the major protein functional domain in Hgene partner, which is a essential gene due to the frame-shifted ORF. CSNK1D-POLR2E seems lost the major protein functional domain in Hgene partner, which is a IUPHAR drug target due to the frame-shifted ORF. CSNK1D-POLR2E seems lost the major protein functional domain in Hgene partner, which is a kinase due to the frame-shifted ORF. CSNK1D-POLR2E seems lost the major protein functional domain in Tgene partner, which is a cell metabolism gene due to the frame-shifted ORF. CSNK1D-POLR2E seems lost the major protein functional domain in Tgene partner, which is a essential gene due to the frame-shifted ORF. |
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
![]() |
Partner | Gene | GO ID | GO term | PubMed ID |
Hgene | CSNK1D | GO:0006468 | protein phosphorylation | 16618118 |
Hgene | CSNK1D | GO:0018105 | peptidyl-serine phosphorylation | 25500533 |
Hgene | CSNK1D | GO:0051225 | spindle assembly | 10826492 |
Tgene | POLR2E | GO:0006366 | transcription by RNA polymerase II | 9852112 |
![]() * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
![]() |
![]() * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
![]() |
Top |
Fusion Gene Sample Information |
![]() |
![]() * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
ChimerDB4 | UCEC | TCGA-D1-A16I-01A | CSNK1D | chr17 | 80223562 | - | POLR2E | chr19 | 1089550 | - |
ChimerDB4 | UCEC | TCGA-D1-A16I-01A | CSNK1D | chr17 | 80223562 | - | POLR2E | chr19 | 1090144 | - |
ChimerDB4 | UCEC | TCGA-D1-A16I-01A | CSNK1D | chr17 | 80223562 | - | POLR2E | chr19 | 1090987 | - |
ChimerDB4 | UCEC | TCGA-D1-A16I | CSNK1D | chr17 | 80223561 | - | POLR2E | chr19 | 1090987 | - |
Top |
Fusion ORF Analysis |
![]() |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
ENST00000392334 | CSNK1D | chr17 | 80223561 | - | ENST00000586746 | POLR2E | chr19 | 1090987 | - | 915 | 503 | 28 | 594 | 188 |
ENST00000392334 | CSNK1D | chr17 | 80223561 | - | ENST00000215587 | POLR2E | chr19 | 1090987 | - | 1375 | 503 | 669 | 40 | 209 |
ENST00000392334 | CSNK1D | chr17 | 80223562 | - | ENST00000586746 | POLR2E | chr19 | 1090144 | - | 834 | 503 | 28 | 513 | 161 |
ENST00000392334 | CSNK1D | chr17 | 80223562 | - | ENST00000215587 | POLR2E | chr19 | 1090144 | - | 1294 | 503 | 588 | 40 | 182 |
ENST00000392334 | CSNK1D | chr17 | 80223562 | - | ENST00000586746 | POLR2E | chr19 | 1090987 | - | 915 | 503 | 28 | 594 | 188 |
ENST00000392334 | CSNK1D | chr17 | 80223562 | - | ENST00000215587 | POLR2E | chr19 | 1090987 | - | 1375 | 503 | 669 | 40 | 209 |
ENST00000392334 | CSNK1D | chr17 | 80223562 | - | ENST00000586746 | POLR2E | chr19 | 1089550 | - | 696 | 503 | 28 | 528 | 166 |
ENST00000392334 | CSNK1D | chr17 | 80223562 | - | ENST00000215587 | POLR2E | chr19 | 1089550 | - | 1156 | 503 | 546 | 40 | 168 |
![]() |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
ENST00000392334 | ENST00000586746 | CSNK1D | chr17 | 80223561 | - | POLR2E | chr19 | 1090987 | - | 0.10631151 | 0.8936885 |
ENST00000392334 | ENST00000215587 | CSNK1D | chr17 | 80223561 | - | POLR2E | chr19 | 1090987 | - | 0.32624516 | 0.6737548 |
ENST00000392334 | ENST00000586746 | CSNK1D | chr17 | 80223562 | - | POLR2E | chr19 | 1090144 | - | 0.18790865 | 0.81209135 |
ENST00000392334 | ENST00000215587 | CSNK1D | chr17 | 80223562 | - | POLR2E | chr19 | 1090144 | - | 0.42973688 | 0.5702631 |
ENST00000392334 | ENST00000586746 | CSNK1D | chr17 | 80223562 | - | POLR2E | chr19 | 1090987 | - | 0.10631151 | 0.8936885 |
ENST00000392334 | ENST00000215587 | CSNK1D | chr17 | 80223562 | - | POLR2E | chr19 | 1090987 | - | 0.32624516 | 0.6737548 |
ENST00000392334 | ENST00000586746 | CSNK1D | chr17 | 80223562 | - | POLR2E | chr19 | 1089550 | - | 0.10991912 | 0.89008087 |
ENST00000392334 | ENST00000215587 | CSNK1D | chr17 | 80223562 | - | POLR2E | chr19 | 1089550 | - | 0.36548504 | 0.6345149 |
Top |
Fusion Amino Acid Sequences |
![]() |
>FusionGDB ID_FusionGDB isoform ID_FGname_Hgene_Hchr_Hbp_Henst_Tgene_Tchr_Tbp_Tenst_length(fusion AA) seq_BP >19821_19821_1_CSNK1D-POLR2E_CSNK1D_chr17_80223561_ENST00000392334_POLR2E_chr19_1090987_ENST00000215587_length(amino acids)=209AA_BP=1 MGSWFSRSLYRASSSVTSSLVMTTCSGTSSCSVMLMSSSCCRNCSRMYLGAMSTRDSSLHHLVDFALNVELRVFGFDTFKLDGNLFSCSN VRTEIDVSEGAAADLPAQPVPVPDSQLHGGGGPIRSCPPGRFLGLNSGRRRRCCRYCGSGSRLRPPHGPAFTIAFLSPRRSQRLNTGRMG -------------------------------------------------------------- >19821_19821_2_CSNK1D-POLR2E_CSNK1D_chr17_80223561_ENST00000392334_POLR2E_chr19_1090987_ENST00000586746_length(amino acids)=188AA_BP=14 MKGDLGPEDPSPSAAGRGQAGPVGAGAAAAALGLSHPPRIEALGAAGRQESDGESGAVRGAEPGAGPAVAAAAAPPPRVQTQEAAGRAGA NRAAAAMELRVGNRYRLGRKIGSGSFGDIYLGTDIAAGEEVAIKLECVKTKHPQLHIESKIYKMMQGGVPGRHGPQVHPGAVSAAGAAHQ -------------------------------------------------------------- >19821_19821_3_CSNK1D-POLR2E_CSNK1D_chr17_80223562_ENST00000392334_POLR2E_chr19_1089550_ENST00000215587_length(amino acids)=168AA_BP=0 MYLPAVSLGRMIFTTSSLHHLVDFALNVELRVFGFDTFKLDGNLFSCSNVRTEIDVSEGAAADLPAQPVPVPDSQLHGGGGPIRSCPPGR -------------------------------------------------------------- >19821_19821_4_CSNK1D-POLR2E_CSNK1D_chr17_80223562_ENST00000392334_POLR2E_chr19_1089550_ENST00000586746_length(amino acids)=166AA_BP= MKGDLGPEDPSPSAAGRGQAGPVGAGAAAAALGLSHPPRIEALGAAGRQESDGESGAVRGAEPGAGPAVAAAAAPPPRVQTQEAAGRAGA -------------------------------------------------------------- >19821_19821_5_CSNK1D-POLR2E_CSNK1D_chr17_80223562_ENST00000392334_POLR2E_chr19_1090144_ENST00000215587_length(amino acids)=182AA_BP=1 MGSWFSRSLYRASSSVTSSLVMTTCSGTSSSLHHLVDFALNVELRVFGFDTFKLDGNLFSCSNVRTEIDVSEGAAADLPAQPVPVPDSQL HGGGGPIRSCPPGRFLGLNSGRRRRCCRYCGSGSRLRPPHGPAFTIAFLSPRRSQRLNTGRMGQSERRRRCSGPYRSRLPSPRRGWTRIF -------------------------------------------------------------- >19821_19821_6_CSNK1D-POLR2E_CSNK1D_chr17_80223562_ENST00000392334_POLR2E_chr19_1090144_ENST00000586746_length(amino acids)=161AA_BP= MKGDLGPEDPSPSAAGRGQAGPVGAGAAAAALGLSHPPRIEALGAAGRQESDGESGAVRGAEPGAGPAVAAAAAPPPRVQTQEAAGRAGA -------------------------------------------------------------- >19821_19821_7_CSNK1D-POLR2E_CSNK1D_chr17_80223562_ENST00000392334_POLR2E_chr19_1090987_ENST00000215587_length(amino acids)=209AA_BP=1 MGSWFSRSLYRASSSVTSSLVMTTCSGTSSCSVMLMSSSCCRNCSRMYLGAMSTRDSSLHHLVDFALNVELRVFGFDTFKLDGNLFSCSN VRTEIDVSEGAAADLPAQPVPVPDSQLHGGGGPIRSCPPGRFLGLNSGRRRRCCRYCGSGSRLRPPHGPAFTIAFLSPRRSQRLNTGRMG -------------------------------------------------------------- >19821_19821_8_CSNK1D-POLR2E_CSNK1D_chr17_80223562_ENST00000392334_POLR2E_chr19_1090987_ENST00000586746_length(amino acids)=188AA_BP=14 MKGDLGPEDPSPSAAGRGQAGPVGAGAAAAALGLSHPPRIEALGAAGRQESDGESGAVRGAEPGAGPAVAAAAAPPPRVQTQEAAGRAGA NRAAAAMELRVGNRYRLGRKIGSGSFGDIYLGTDIAAGEEVAIKLECVKTKHPQLHIESKIYKMMQGGVPGRHGPQVHPGAVSAAGAAHQ -------------------------------------------------------------- |
Top |
Fusion Protein Functional Features |
![]() Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr17:80223561/chr19:1090987) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
![]() |
![]() |
Hgene | Tgene |
CSNK1D | . |
FUNCTION: Essential serine/threonine-protein kinase that regulates diverse cellular growth and survival processes including Wnt signaling, DNA repair and circadian rhythms. It can phosphorylate a large number of proteins. Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates. Phosphorylates connexin-43/GJA1, MAP1A, SNAPIN, MAPT/TAU, TOP2A, DCK, HIF1A, EIF6, p53/TP53, DVL2, DVL3, ESR1, AIB1/NCOA3, DNMT1, PKD2, YAP1, PER1 and PER2. Central component of the circadian clock. In balance with PP1, determines the circadian period length through the regulation of the speed and rhythmicity of PER1 and PER2 phosphorylation. Controls PER1 and PER2 nuclear transport and degradation. YAP1 phosphorylation promotes its SCF(beta-TRCP) E3 ubiquitin ligase-mediated ubiquitination and subsequent degradation. DNMT1 phosphorylation reduces its DNA-binding activity. Phosphorylation of ESR1 and AIB1/NCOA3 stimulates their activity and coactivation. Phosphorylation of DVL2 and DVL3 regulates WNT3A signaling pathway that controls neurite outgrowth. EIF6 phosphorylation promotes its nuclear export. Triggers down-regulation of dopamine receptors in the forebrain. Activates DCK in vitro by phosphorylation. TOP2A phosphorylation favors DNA cleavable complex formation. May regulate the formation of the mitotic spindle apparatus in extravillous trophoblast. Modulates connexin-43/GJA1 gap junction assembly by phosphorylation. Probably involved in lymphocyte physiology. Regulates fast synaptic transmission mediated by glutamate. {ECO:0000269|PubMed:10606744, ECO:0000269|PubMed:12270943, ECO:0000269|PubMed:14761950, ECO:0000269|PubMed:16027726, ECO:0000269|PubMed:17562708, ECO:0000269|PubMed:17962809, ECO:0000269|PubMed:19043076, ECO:0000269|PubMed:19339517, ECO:0000269|PubMed:20041275, ECO:0000269|PubMed:20048001, ECO:0000269|PubMed:20407760, ECO:0000269|PubMed:20637175, ECO:0000269|PubMed:20696890, ECO:0000269|PubMed:20699359, ECO:0000269|PubMed:21084295, ECO:0000269|PubMed:21422228, ECO:0000269|PubMed:23636092}. | FUNCTION: Might normally function as a transcriptional repressor. EWS-fusion-proteins (EFPS) may play a role in the tumorigenic process. They may disturb gene expression by mimicking, or interfering with the normal function of CTD-POLII within the transcription initiation complex. They may also contribute to an aberrant activation of the fusion protein target genes. |
![]() |
- Retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Hgene | CSNK1D | chr17:80223561 | chr19:1090987 | ENST00000314028 | - | 2 | 9 | 15_23 | 62.333333333333336 | 416.0 | Nucleotide binding | ATP |
Hgene | CSNK1D | chr17:80223561 | chr19:1090987 | ENST00000392334 | - | 2 | 10 | 15_23 | 62.333333333333336 | 420.3333333333333 | Nucleotide binding | ATP |
Hgene | CSNK1D | chr17:80223562 | chr19:1089550 | ENST00000314028 | - | 2 | 9 | 15_23 | 62.333333333333336 | 416.0 | Nucleotide binding | ATP |
Hgene | CSNK1D | chr17:80223562 | chr19:1089550 | ENST00000392334 | - | 2 | 10 | 15_23 | 62.333333333333336 | 420.3333333333333 | Nucleotide binding | ATP |
Hgene | CSNK1D | chr17:80223562 | chr19:1090144 | ENST00000314028 | - | 2 | 9 | 15_23 | 62.333333333333336 | 416.0 | Nucleotide binding | ATP |
Hgene | CSNK1D | chr17:80223562 | chr19:1090144 | ENST00000392334 | - | 2 | 10 | 15_23 | 62.333333333333336 | 420.3333333333333 | Nucleotide binding | ATP |
Hgene | CSNK1D | chr17:80223562 | chr19:1090987 | ENST00000314028 | - | 2 | 9 | 15_23 | 62.333333333333336 | 416.0 | Nucleotide binding | ATP |
Hgene | CSNK1D | chr17:80223562 | chr19:1090987 | ENST00000392334 | - | 2 | 10 | 15_23 | 62.333333333333336 | 420.3333333333333 | Nucleotide binding | ATP |
- Not-retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Hgene | CSNK1D | chr17:80223561 | chr19:1090987 | ENST00000314028 | - | 2 | 9 | 9_277 | 62.333333333333336 | 416.0 | Domain | Protein kinase |
Hgene | CSNK1D | chr17:80223561 | chr19:1090987 | ENST00000392334 | - | 2 | 10 | 9_277 | 62.333333333333336 | 420.3333333333333 | Domain | Protein kinase |
Hgene | CSNK1D | chr17:80223562 | chr19:1089550 | ENST00000314028 | - | 2 | 9 | 9_277 | 62.333333333333336 | 416.0 | Domain | Protein kinase |
Hgene | CSNK1D | chr17:80223562 | chr19:1089550 | ENST00000392334 | - | 2 | 10 | 9_277 | 62.333333333333336 | 420.3333333333333 | Domain | Protein kinase |
Hgene | CSNK1D | chr17:80223562 | chr19:1090144 | ENST00000314028 | - | 2 | 9 | 9_277 | 62.333333333333336 | 416.0 | Domain | Protein kinase |
Hgene | CSNK1D | chr17:80223562 | chr19:1090144 | ENST00000392334 | - | 2 | 10 | 9_277 | 62.333333333333336 | 420.3333333333333 | Domain | Protein kinase |
Hgene | CSNK1D | chr17:80223562 | chr19:1090987 | ENST00000314028 | - | 2 | 9 | 9_277 | 62.333333333333336 | 416.0 | Domain | Protein kinase |
Hgene | CSNK1D | chr17:80223562 | chr19:1090987 | ENST00000392334 | - | 2 | 10 | 9_277 | 62.333333333333336 | 420.3333333333333 | Domain | Protein kinase |
Hgene | CSNK1D | chr17:80223561 | chr19:1090987 | ENST00000314028 | - | 2 | 9 | 278_364 | 62.333333333333336 | 416.0 | Region | Note=Centrosomal localization signal (CLS) |
Hgene | CSNK1D | chr17:80223561 | chr19:1090987 | ENST00000314028 | - | 2 | 9 | 317_342 | 62.333333333333336 | 416.0 | Region | Autoinhibitory |
Hgene | CSNK1D | chr17:80223561 | chr19:1090987 | ENST00000392334 | - | 2 | 10 | 278_364 | 62.333333333333336 | 420.3333333333333 | Region | Note=Centrosomal localization signal (CLS) |
Hgene | CSNK1D | chr17:80223561 | chr19:1090987 | ENST00000392334 | - | 2 | 10 | 317_342 | 62.333333333333336 | 420.3333333333333 | Region | Autoinhibitory |
Hgene | CSNK1D | chr17:80223562 | chr19:1089550 | ENST00000314028 | - | 2 | 9 | 278_364 | 62.333333333333336 | 416.0 | Region | Note=Centrosomal localization signal (CLS) |
Hgene | CSNK1D | chr17:80223562 | chr19:1089550 | ENST00000314028 | - | 2 | 9 | 317_342 | 62.333333333333336 | 416.0 | Region | Autoinhibitory |
Hgene | CSNK1D | chr17:80223562 | chr19:1089550 | ENST00000392334 | - | 2 | 10 | 278_364 | 62.333333333333336 | 420.3333333333333 | Region | Note=Centrosomal localization signal (CLS) |
Hgene | CSNK1D | chr17:80223562 | chr19:1089550 | ENST00000392334 | - | 2 | 10 | 317_342 | 62.333333333333336 | 420.3333333333333 | Region | Autoinhibitory |
Hgene | CSNK1D | chr17:80223562 | chr19:1090144 | ENST00000314028 | - | 2 | 9 | 278_364 | 62.333333333333336 | 416.0 | Region | Note=Centrosomal localization signal (CLS) |
Hgene | CSNK1D | chr17:80223562 | chr19:1090144 | ENST00000314028 | - | 2 | 9 | 317_342 | 62.333333333333336 | 416.0 | Region | Autoinhibitory |
Hgene | CSNK1D | chr17:80223562 | chr19:1090144 | ENST00000392334 | - | 2 | 10 | 278_364 | 62.333333333333336 | 420.3333333333333 | Region | Note=Centrosomal localization signal (CLS) |
Hgene | CSNK1D | chr17:80223562 | chr19:1090144 | ENST00000392334 | - | 2 | 10 | 317_342 | 62.333333333333336 | 420.3333333333333 | Region | Autoinhibitory |
Hgene | CSNK1D | chr17:80223562 | chr19:1090987 | ENST00000314028 | - | 2 | 9 | 278_364 | 62.333333333333336 | 416.0 | Region | Note=Centrosomal localization signal (CLS) |
Hgene | CSNK1D | chr17:80223562 | chr19:1090987 | ENST00000314028 | - | 2 | 9 | 317_342 | 62.333333333333336 | 416.0 | Region | Autoinhibitory |
Hgene | CSNK1D | chr17:80223562 | chr19:1090987 | ENST00000392334 | - | 2 | 10 | 278_364 | 62.333333333333336 | 420.3333333333333 | Region | Note=Centrosomal localization signal (CLS) |
Hgene | CSNK1D | chr17:80223562 | chr19:1090987 | ENST00000392334 | - | 2 | 10 | 317_342 | 62.333333333333336 | 420.3333333333333 | Region | Autoinhibitory |
Top |
Fusion Protein-Protein Interaction |
![]() |
![]() |
Gene | PPI interactors |
![]() |
Gene | STRING network |
CSNK1D | |
POLR2E |
![]() |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
![]() |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
Related Drugs to CSNK1D-POLR2E |
![]() (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Drug | Source | PMID |
Top |
Related Diseases to CSNK1D-POLR2E |
![]() (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Disease | Source | PMID |
![]() (DisGeNet 4.0) |
Partner | Gene | Disease ID | Disease name | # pubmeds | Source |