UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
![]() |
|||||||
|
Fusion Protein:CTNNA3-MGMT |
Fusion Protein Summary |
![]() |
Fusion partner gene information | Fusion gene name: CTNNA3-MGMT | FusionPDB ID: 20297 | FusionGDB2.0 ID: 20297 | Hgene | Tgene | Gene symbol | CTNNA3 | MGMT | Gene ID | 29119 | 4255 |
Gene name | catenin alpha 3 | O-6-methylguanine-DNA methyltransferase | |
Synonyms | ARVD13|VR22 | - | |
Cytomap | 10q21.3 | 10q26.3 | |
Type of gene | protein-coding | protein-coding | |
Description | catenin alpha-3alpha-T-cateninalpha-catenin-like proteincatenin (cadherin-associated protein), alpha 3 | methylated-DNA--protein-cysteine methyltransferase6-O-methylguanine-DNA methyltransferaseO-6-methylguanine-DNA-alkyltransferaseO6-methylguanine-DNA methyltransferasemethylguanine-DNA methyltransferase | |
Modification date | 20200313 | 20200315 | |
UniProtAcc | Q9UI47 | P16455 | |
Ensembl transtripts involved in fusion gene | ENST ids | ENST00000373744, ENST00000433211, ENST00000373735, ENST00000545309, | ENST00000462672, ENST00000306010, |
Fusion gene scores for assessment (based on all fusion genes of FusionGDB 2.0) | * DoF score | 16 X 15 X 3=720 | 19 X 11 X 7=1463 |
# samples | 16 | 18 | |
** MAII score | log2(16/720*10)=-2.16992500144231 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | log2(18/1463*10)=-3.02286095780881 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | |
Context (manual curation of fusion genes in FusionPDB) | PubMed: CTNNA3 [Title/Abstract] AND MGMT [Title/Abstract] AND fusion [Title/Abstract] | ||
Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) | CTNNA3(68381450)-MGMT(131334505), # samples:3 | ||
Anticipated loss of major functional domain due to fusion event. | CTNNA3-MGMT seems lost the major protein functional domain in Hgene partner, which is a tumor suppressor due to the frame-shifted ORF. CTNNA3-MGMT seems lost the major protein functional domain in Tgene partner, which is a CGC due to the frame-shifted ORF. |
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
![]() |
Partner | Gene | GO ID | GO term | PubMed ID |
Tgene | MGMT | GO:0043066 | negative regulation of apoptotic process | 24147153 |
Tgene | MGMT | GO:2000781 | positive regulation of double-strand break repair | 24147153 |
![]() * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
![]() |
![]() * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
![]() |
Top |
Fusion Gene Sample Information |
![]() |
![]() * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
ChimerDB4 | BRCA | TCGA-AO-A03V-01A | CTNNA3 | chr10 | 68381450 | - | MGMT | chr10 | 131334505 | + |
Top |
Fusion ORF Analysis |
![]() |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
ENST00000373744 | CTNNA3 | chr10 | 68381450 | - | ENST00000306010 | MGMT | chr10 | 131334505 | + | 3020 | 1374 | 0 | 2009 | 669 |
![]() |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
ENST00000373744 | ENST00000306010 | CTNNA3 | chr10 | 68381450 | - | MGMT | chr10 | 131334505 | + | 0.002778667 | 0.99722135 |
Top |
Fusion Amino Acid Sequences |
![]() |
>FusionGDB ID_FusionGDB isoform ID_FGname_Hgene_Hchr_Hbp_Henst_Tgene_Tchr_Tbp_Tenst_length(fusion AA) seq_BP >20297_20297_1_CTNNA3-MGMT_CTNNA3_chr10_68381450_ENST00000373744_MGMT_chr10_131334505_ENST00000306010_length(amino acids)=669AA_BP=458 MSAETPITLNIDPQDLQVQTFTVEKLLEPLIIQVTTLVNCPQNPSSRKKGRSKRASVLLASVEEATWNLLDKGEKIAQEATVLKDELTAS LEEVRKESEALKVSAERFTDDPCFLPKREAVVQAARALLAAVTRLLILADMIDVMCLLQHVSAFQRTFESLKNVANKSDLQKTYQKLGKE LENLDYLAFKRQQDLKSPNQRDEIAGARASLKENSPLLHSICSACLEHSDVASLKASKDTVCEEIQNALNVISNASQGIQNMTTPPEPQA ATLGSALDELENLIVLNPLTVTEEEIRPSLEKRLEAIISGAALLADSSCTRDLHRERIIAECNAIRQALQDLLSEYMNNAGKKERSNTLN IALDNMCKKTRDLRRQLRKAIIDHVSDSFLDTTVPLLVLIEAAKNGREKEIKEYAAIFHEHTSRLVEVANLACSMSTNEDGIKIVKIAAN HLETLCPQVLGKMDKDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVEVPAPAAVLGGPEPLMQCTAWLNAYFHQPEAIEE FPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAALAGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWL -------------------------------------------------------------- |
Top |
Fusion Protein Functional Features |
![]() Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr10:68381450/chr10:131334505) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
![]() |
![]() |
Hgene | Tgene |
CTNNA3 | MGMT |
FUNCTION: May be involved in formation of stretch-resistant cell-cell adhesion complexes. {ECO:0000303|PubMed:11590244}. | FUNCTION: Involved in the cellular defense against the biological effects of O6-methylguanine (O6-MeG) and O4-methylthymine (O4-MeT) in DNA. Repairs the methylated nucleobase in DNA by stoichiometrically transferring the methyl group to a cysteine residue in the enzyme. This is a suicide reaction: the enzyme is irreversibly inactivated. |
![]() |
- Retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Hgene | CTNNA3 | chr10:68381450 | chr10:131334505 | ENST00000373744 | - | 9 | 17 | 325_379 | 458.0 | 896.0 | Coiled coil | Ontology_term=ECO:0000255 |
Hgene | CTNNA3 | chr10:68381450 | chr10:131334505 | ENST00000373744 | - | 9 | 17 | 74_111 | 458.0 | 896.0 | Coiled coil | Ontology_term=ECO:0000255 |
Hgene | CTNNA3 | chr10:68381450 | chr10:131334505 | ENST00000433211 | - | 10 | 18 | 325_379 | 458.0 | 896.0 | Coiled coil | Ontology_term=ECO:0000255 |
Hgene | CTNNA3 | chr10:68381450 | chr10:131334505 | ENST00000433211 | - | 10 | 18 | 74_111 | 458.0 | 896.0 | Coiled coil | Ontology_term=ECO:0000255 |
- Not-retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Top |
Fusion Protein-Protein Interaction |
![]() |
![]() |
Gene | PPI interactors |
![]() |
Gene | STRING network |
CTNNA3 | |
MGMT |
![]() |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
![]() |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
Related Drugs to CTNNA3-MGMT |
![]() (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Drug | Source | PMID |
Top |
Related Diseases to CTNNA3-MGMT |
![]() (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Disease | Source | PMID |
![]() (DisGeNet 4.0) |
Partner | Gene | Disease ID | Disease name | # pubmeds | Source |