UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
![]() |
|||||||
|
Fusion Protein:CUL3-DARS |
Fusion Protein Summary |
![]() |
Fusion partner gene information | Fusion gene name: CUL3-DARS | FusionPDB ID: 20665 | FusionGDB2.0 ID: 20665 | Hgene | Tgene | Gene symbol | CUL3 | DARS | Gene ID | 8452 | 1615 |
Gene name | cullin 3 | aspartyl-tRNA synthetase 1 | |
Synonyms | CUL-3|PHA2E | DARS|HBSL|aspRS | |
Cytomap | 2q36.2 | 2q21.3 | |
Type of gene | protein-coding | protein-coding | |
Description | cullin-3 | aspartate--tRNA ligase, cytoplasmicaspartate tRNA ligase 1, cytoplasmicaspartyl-tRNA synthetase, cytoplasmiccell proliferation-inducing gene 40 proteintesticular tissue protein Li 192 | |
Modification date | 20200327 | 20200313 | |
UniProtAcc | Q13618 | Q6PI48 | |
Ensembl transtripts involved in fusion gene | ENST ids | ENST00000264414, ENST00000344951, ENST00000409096, ENST00000409777, ENST00000432260, | ENST00000463008, ENST00000264161, ENST00000537273, |
Fusion gene scores for assessment (based on all fusion genes of FusionGDB 2.0) | * DoF score | 12 X 12 X 7=1008 | 8 X 9 X 5=360 |
# samples | 14 | 8 | |
** MAII score | log2(14/1008*10)=-2.84799690655495 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | log2(8/360*10)=-2.16992500144231 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | |
Context (manual curation of fusion genes in FusionPDB) | PubMed: CUL3 [Title/Abstract] AND DARS [Title/Abstract] AND fusion [Title/Abstract] | ||
Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) | CUL3(225378241)-DARS(136670136), # samples:1 | ||
Anticipated loss of major functional domain due to fusion event. | CUL3-DARS seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. CUL3-DARS seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. CUL3-DARS seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. CUL3-DARS seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. CUL3-DARS seems lost the major protein functional domain in Hgene partner, which is a CGC due to the frame-shifted ORF. CUL3-DARS seems lost the major protein functional domain in Hgene partner, which is a epigenetic factor due to the frame-shifted ORF. CUL3-DARS seems lost the major protein functional domain in Tgene partner, which is a essential gene due to the frame-shifted ORF. |
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
![]() |
Partner | Gene | GO ID | GO term | PubMed ID |
Hgene | CUL3 | GO:0000209 | protein polyubiquitination | 19261606 |
Hgene | CUL3 | GO:0006511 | ubiquitin-dependent protein catabolic process | 25401743|27561354 |
Hgene | CUL3 | GO:0006513 | protein monoubiquitination | 22358839 |
Hgene | CUL3 | GO:0006888 | ER to Golgi vesicle-mediated transport | 22358839 |
Hgene | CUL3 | GO:0016567 | protein ubiquitination | 17543862|19782033|19995937|20389280|23213400 |
Hgene | CUL3 | GO:0031145 | anaphase-promoting complex-dependent catabolic process | 10500095 |
Hgene | CUL3 | GO:0043161 | proteasome-mediated ubiquitin-dependent protein catabolic process | 19261606|19782033|20389280 |
Hgene | CUL3 | GO:0071630 | nuclear protein quality control by the ubiquitin-proteasome system | 27561354 |
![]() * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
![]() |
![]() * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
![]() |
Top |
Fusion Gene Sample Information |
![]() |
![]() * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
ChimerDB4 | KIRC | TCGA-CJ-4636-01A | CUL3 | chr2 | 225378241 | - | DARS | chr2 | 136670136 | - |
Top |
Fusion ORF Analysis |
![]() |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
ENST00000264414 | CUL3 | chr2 | 225378241 | - | ENST00000264161 | DARS | chr2 | 136670136 | - | 1989 | 993 | 339 | 1349 | 336 |
ENST00000264414 | CUL3 | chr2 | 225378241 | - | ENST00000537273 | DARS | chr2 | 136670136 | - | 1404 | 993 | 339 | 1349 | 336 |
ENST00000344951 | CUL3 | chr2 | 225378241 | - | ENST00000264161 | DARS | chr2 | 136670136 | - | 1836 | 840 | 384 | 1196 | 270 |
ENST00000344951 | CUL3 | chr2 | 225378241 | - | ENST00000537273 | DARS | chr2 | 136670136 | - | 1251 | 840 | 384 | 1196 | 270 |
ENST00000409096 | CUL3 | chr2 | 225378241 | - | ENST00000264161 | DARS | chr2 | 136670136 | - | 1721 | 725 | 53 | 1081 | 342 |
ENST00000409096 | CUL3 | chr2 | 225378241 | - | ENST00000537273 | DARS | chr2 | 136670136 | - | 1136 | 725 | 53 | 1081 | 342 |
![]() |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
ENST00000264414 | ENST00000264161 | CUL3 | chr2 | 225378241 | - | DARS | chr2 | 136670136 | - | 0.000673067 | 0.99932694 |
ENST00000264414 | ENST00000537273 | CUL3 | chr2 | 225378241 | - | DARS | chr2 | 136670136 | - | 0.001809187 | 0.9981908 |
ENST00000344951 | ENST00000264161 | CUL3 | chr2 | 225378241 | - | DARS | chr2 | 136670136 | - | 0.000956877 | 0.99904305 |
ENST00000344951 | ENST00000537273 | CUL3 | chr2 | 225378241 | - | DARS | chr2 | 136670136 | - | 0.002691174 | 0.99730885 |
ENST00000409096 | ENST00000264161 | CUL3 | chr2 | 225378241 | - | DARS | chr2 | 136670136 | - | 0.000212479 | 0.9997875 |
ENST00000409096 | ENST00000537273 | CUL3 | chr2 | 225378241 | - | DARS | chr2 | 136670136 | - | 0.000417496 | 0.99958247 |
Top |
Fusion Amino Acid Sequences |
![]() |
>FusionGDB ID_FusionGDB isoform ID_FGname_Hgene_Hchr_Hbp_Henst_Tgene_Tchr_Tbp_Tenst_length(fusion AA) seq_BP >20665_20665_1_CUL3-DARS_CUL3_chr2_225378241_ENST00000264414_DARS_chr2_136670136_ENST00000264161_length(amino acids)=336AA_BP=218 MSNLSKGTGSRKDTKMRIRAFPMTMDEKYVNSIWDLLKNAIQEIQRKNNSGLSFEELYRNAYTMVLHKHGEKLYTGLREVVTEHLINKVR EDVLNSLNNNFLQTLNQAWNDHQTAMVMIRDILMYMDRVYVQQNNVENVYNLGLIIFRDQVVRYGCIRDHLRQTLLDMIARERKGEVVDR GAIRNACQMLMILGLEGRSVYEEDFEAPFLEMSAEFFQYDTDFYILDKYPLAVRPFYTMPDPRNPKQSNSYDMFMRGEEILSGAQRIHDP -------------------------------------------------------------- >20665_20665_2_CUL3-DARS_CUL3_chr2_225378241_ENST00000264414_DARS_chr2_136670136_ENST00000537273_length(amino acids)=336AA_BP=218 MSNLSKGTGSRKDTKMRIRAFPMTMDEKYVNSIWDLLKNAIQEIQRKNNSGLSFEELYRNAYTMVLHKHGEKLYTGLREVVTEHLINKVR EDVLNSLNNNFLQTLNQAWNDHQTAMVMIRDILMYMDRVYVQQNNVENVYNLGLIIFRDQVVRYGCIRDHLRQTLLDMIARERKGEVVDR GAIRNACQMLMILGLEGRSVYEEDFEAPFLEMSAEFFQYDTDFYILDKYPLAVRPFYTMPDPRNPKQSNSYDMFMRGEEILSGAQRIHDP -------------------------------------------------------------- >20665_20665_3_CUL3-DARS_CUL3_chr2_225378241_ENST00000344951_DARS_chr2_136670136_ENST00000264161_length(amino acids)=270AA_BP=152 MSNLSKGTGSRKDTKMRIRAFPVREDVLNSLNNNFLQTLNQAWNDHQTAMVMIRDILMYMDRVYVQQNNVENVYNLGLIIFRDQVVRYGC IRDHLRQTLLDMIARERKGEVVDRGAIRNACQMLMILGLEGRSVYEEDFEAPFLEMSAEFFQYDTDFYILDKYPLAVRPFYTMPDPRNPK QSNSYDMFMRGEEILSGAQRIHDPQLLTERALHHGIDLEKIKAYIDSFRFGAPPHAGGGIGLERVTMLFLGLHNVRQTSMFPRDPKRLTP -------------------------------------------------------------- >20665_20665_4_CUL3-DARS_CUL3_chr2_225378241_ENST00000344951_DARS_chr2_136670136_ENST00000537273_length(amino acids)=270AA_BP=152 MSNLSKGTGSRKDTKMRIRAFPVREDVLNSLNNNFLQTLNQAWNDHQTAMVMIRDILMYMDRVYVQQNNVENVYNLGLIIFRDQVVRYGC IRDHLRQTLLDMIARERKGEVVDRGAIRNACQMLMILGLEGRSVYEEDFEAPFLEMSAEFFQYDTDFYILDKYPLAVRPFYTMPDPRNPK QSNSYDMFMRGEEILSGAQRIHDPQLLTERALHHGIDLEKIKAYIDSFRFGAPPHAGGGIGLERVTMLFLGLHNVRQTSMFPRDPKRLTP -------------------------------------------------------------- >20665_20665_5_CUL3-DARS_CUL3_chr2_225378241_ENST00000409096_DARS_chr2_136670136_ENST00000264161_length(amino acids)=342AA_BP=224 MLRIHFFSFSFNLSHDVVLSVITEPSRCMTMDEKYVNSIWDLLKNAIQEIQRKNNSGLSFEELYRNAYTMVLHKHGEKLYTGLREVVTEH LINKVREDVLNSLNNNFLQTLNQAWNDHQTAMVMIRDILMYMDRVYVQQNNVENVYNLGLIIFRDQVVRYGCIRDHLRQTLLDMIARERK GEVVDRGAIRNACQMLMILGLEGRSVYEEDFEAPFLEMSAEFFQYDTDFYILDKYPLAVRPFYTMPDPRNPKQSNSYDMFMRGEEILSGA -------------------------------------------------------------- >20665_20665_6_CUL3-DARS_CUL3_chr2_225378241_ENST00000409096_DARS_chr2_136670136_ENST00000537273_length(amino acids)=342AA_BP=224 MLRIHFFSFSFNLSHDVVLSVITEPSRCMTMDEKYVNSIWDLLKNAIQEIQRKNNSGLSFEELYRNAYTMVLHKHGEKLYTGLREVVTEH LINKVREDVLNSLNNNFLQTLNQAWNDHQTAMVMIRDILMYMDRVYVQQNNVENVYNLGLIIFRDQVVRYGCIRDHLRQTLLDMIARERK GEVVDRGAIRNACQMLMILGLEGRSVYEEDFEAPFLEMSAEFFQYDTDFYILDKYPLAVRPFYTMPDPRNPKQSNSYDMFMRGEEILSGA -------------------------------------------------------------- |
Top |
Fusion Protein Functional Features |
![]() Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr2:225378241/chr2:136670136) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
![]() |
![]() |
Hgene | Tgene |
CUL3 | DARS |
FUNCTION: Core component of multiple cullin-RING-based BCR (BTB-CUL3-RBX1) E3 ubiquitin-protein ligase complexes which mediate the ubiquitination and subsequent proteasomal degradation of target proteins. BCR complexes and ARIH1 collaborate in tandem to mediate ubiquitination of target proteins (PubMed:27565346). As a scaffold protein may contribute to catalysis through positioning of the substrate and the ubiquitin-conjugating enzyme. The E3 ubiquitin-protein ligase activity of the complex is dependent on the neddylation of the cullin subunit and is inhibited by the association of the deneddylated cullin subunit with TIP120A/CAND1. The functional specificity of the BCR complex depends on the BTB domain-containing protein as the substrate recognition component. BCR(KLHL42) is involved in ubiquitination of KATNA1. BCR(SPOP) is involved in ubiquitination of BMI1/PCGF4, BRMS1, MACROH2A1 and DAXX, GLI2 and GLI3. Can also form a cullin-RING-based BCR (BTB-CUL3-RBX1) E3 ubiquitin-protein ligase complex containing homodimeric SPOPL or the heterodimer formed by SPOP and SPOPL; these complexes have lower ubiquitin ligase activity. BCR(KLHL9-KLHL13) controls the dynamic behavior of AURKB on mitotic chromosomes and thereby coordinates faithful mitotic progression and completion of cytokinesis. BCR(KLHL12) is involved in ER-Golgi transport by regulating the size of COPII coats, thereby playing a key role in collagen export, which is required for embryonic stem (ES) cells division: BCR(KLHL12) acts by mediating monoubiquitination of SEC31 (SEC31A or SEC31B) (PubMed:22358839, PubMed:27716508). BCR(KLHL3) acts as a regulator of ion transport in the distal nephron; by mediating ubiquitination of WNK4 (PubMed:23387299, PubMed:23453970, PubMed:23576762). The BCR(KLHL20) E3 ubiquitin ligase complex is involved in interferon response and anterograde Golgi to endosome transport: it mediates both ubiquitination leading to degradation and 'Lys-33'-linked ubiquitination (PubMed:20389280, PubMed:21840486, PubMed:21670212, PubMed:24768539). The BCR(KLHL21) E3 ubiquitin ligase complex regulates localization of the chromosomal passenger complex (CPC) from chromosomes to the spindle midzone in anaphase and mediates the ubiquitination of AURKB (PubMed:19995937). The BCR(KLHL22) ubiquitin ligase complex mediates monoubiquitination of PLK1, leading to PLK1 dissociation from phosphoreceptor proteins and subsequent removal from kinetochores, allowing silencing of the spindle assembly checkpoint (SAC) and chromosome segregation (PubMed:23455478). The BCR(KLHL22) ubiquitin ligase complex is also responsible for the amino acid-stimulated 'Lys-48' polyubiquitination and proteasomal degradation of DEPDC5. Through the degradation of DEPDC5, releases the GATOR1 complex-mediated inhibition of the TORC1 pathway (PubMed:29769719). The BCR(KLHL25) ubiquitin ligase complex is involved in translational homeostasis by mediating ubiquitination and subsequent degradation of hypophosphorylated EIF4EBP1 (4E-BP1) (PubMed:22578813). The BCR(KBTBD8) complex acts by mediating monoubiquitination of NOLC1 and TCOF1, leading to remodel the translational program of differentiating cells in favor of neural crest specification (PubMed:26399832). Involved in ubiquitination of cyclin E and of cyclin D1 (in vitro) thus involved in regulation of G1/S transition. Involved in the ubiquitination of KEAP1, ENC1 and KLHL41 (PubMed:15983046). In concert with ATF2 and RBX1, promotes degradation of KAT5 thereby attenuating its ability to acetylate and activate ATM. The BCR(KCTD17) E3 ubiquitin ligase complex mediates ubiquitination and degradation of TCHP, a down-regulator of cilium assembly, thereby inducing ciliogenesis (PubMed:25270598). The BCR(KLHL24) E3 ubiquitin ligase complex mediates ubiquitination of KRT14, controls KRT14 levels during keratinocytes differentiation, and is essential for skin integrity (PubMed:27798626). The BCR(KLHL18) E3 ubiquitin ligase complex mediates the ubiquitination of AURKA leading to its activation at the centrosome which is required for initiating mitotic entry (PubMed:23213400). The BCR(KEAP1) E3 ubiquitin ligase complex acts as a key sensor of oxidative and electrophilic stress by mediating ubiquitination and degradation of NFE2L2/NRF2, a transcription factor regulating expression of many cytoprotective genes (PubMed:15601839, PubMed:16006525). {ECO:0000269|PubMed:10500095, ECO:0000269|PubMed:11311237, ECO:0000269|PubMed:15601839, ECO:0000269|PubMed:15897469, ECO:0000269|PubMed:15983046, ECO:0000269|PubMed:16006525, ECO:0000269|PubMed:16524876, ECO:0000269|PubMed:17543862, ECO:0000269|PubMed:18397884, ECO:0000269|PubMed:19261606, ECO:0000269|PubMed:19995937, ECO:0000269|PubMed:20389280, ECO:0000269|PubMed:21670212, ECO:0000269|PubMed:21840486, ECO:0000269|PubMed:22085717, ECO:0000269|PubMed:22358839, ECO:0000269|PubMed:22578813, ECO:0000269|PubMed:22632832, ECO:0000269|PubMed:23213400, ECO:0000269|PubMed:23387299, ECO:0000269|PubMed:23453970, ECO:0000269|PubMed:23455478, ECO:0000269|PubMed:23576762, ECO:0000269|PubMed:24768539, ECO:0000269|PubMed:25270598, ECO:0000269|PubMed:26399832, ECO:0000269|PubMed:27565346, ECO:0000269|PubMed:27716508, ECO:0000269|PubMed:27798626, ECO:0000269|PubMed:29769719}. |
![]() |
- Retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Tgene | DARS | chr2:225378241 | chr2:136670136 | ENST00000264161 | 11 | 16 | 472_475 | 383.0 | 502.0 | Nucleotide binding | ATP | |
Tgene | DARS | chr2:225378241 | chr2:136670136 | ENST00000264161 | 11 | 16 | 411_415 | 383.0 | 502.0 | Region | Binding site for the 3'-end of tRNA |
- Not-retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Tgene | DARS | chr2:225378241 | chr2:136670136 | ENST00000264161 | 11 | 16 | 273_275 | 383.0 | 502.0 | Nucleotide binding | ATP | |
Tgene | DARS | chr2:225378241 | chr2:136670136 | ENST00000264161 | 11 | 16 | 281_283 | 383.0 | 502.0 | Nucleotide binding | ATP | |
Tgene | DARS | chr2:225378241 | chr2:136670136 | ENST00000264161 | 11 | 16 | 251_254 | 383.0 | 502.0 | Region | Aspartate |
Top |
Fusion Protein-Protein Interaction |
![]() |
![]() |
Gene | PPI interactors |
![]() |
Gene | STRING network |
CUL3 | |
DARS |
![]() |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
![]() |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
Related Drugs to CUL3-DARS |
![]() (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Drug | Source | PMID |
Top |
Related Diseases to CUL3-DARS |
![]() (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Disease | Source | PMID |
![]() (DisGeNet 4.0) |
Partner | Gene | Disease ID | Disease name | # pubmeds | Source |