UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
![]() |
|||||||
|
Fusion Protein:CYP2E1-REG3A |
Fusion Protein Summary |
![]() |
Fusion partner gene information | Fusion gene name: CYP2E1-REG3A | FusionPDB ID: 21063 | FusionGDB2.0 ID: 21063 | Hgene | Tgene | Gene symbol | CYP2E1 | REG3A | Gene ID | 1571 | 5068 |
Gene name | cytochrome P450 family 2 subfamily E member 1 | regenerating family member 3 alpha | |
Synonyms | CPE1|CYP2E|P450-J|P450C2E | HIP|HIP/PAP|INGAP|PAP|PAP-H|PAP1|PBCGF|REG-III|REG3 | |
Cytomap | 10q26.3 | 2p12 | |
Type of gene | protein-coding | protein-coding | |
Description | cytochrome P450 2E14-nitrophenol 2-hydroxylaseCYPIIE1cytochrome P450, family 2, subfamily E, polypeptide 1cytochrome P450, subfamily IIE (ethanol-inducible), polypeptide 1cytochrome P450-Jflavoprotein-linked monooxygenasemicrosomal monooxygenasexe | regenerating islet-derived protein 3-alphaPAP homologous proteinREG-3-alphahepatocarcinoma-intestine-pancreashepatointestinal pancreatic proteinhuman proislet peptidepancreatic beta cell growth factorpancreatitis-associated protein 1proliferation- | |
Modification date | 20200315 | 20200315 | |
UniProtAcc | P05181 | . | |
Ensembl transtripts involved in fusion gene | ENST ids | ENST00000252945, ENST00000463117, ENST00000480558, | ENST00000305165, ENST00000393878, ENST00000409839, |
Fusion gene scores for assessment (based on all fusion genes of FusionGDB 2.0) | * DoF score | 8 X 5 X 3=120 | 5 X 5 X 3=75 |
# samples | 8 | 4 | |
** MAII score | log2(8/120*10)=-0.584962500721156 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | log2(4/75*10)=-0.906890595608519 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | |
Context (manual curation of fusion genes in FusionPDB) | PubMed: CYP2E1 [Title/Abstract] AND REG3A [Title/Abstract] AND fusion [Title/Abstract] | ||
Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) | CYP2E1(135341076)-REG3A(79384824), # samples:1 | ||
Anticipated loss of major functional domain due to fusion event. | CYP2E1-REG3A seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. CYP2E1-REG3A seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. |
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
![]() |
Partner | Gene | GO ID | GO term | PubMed ID |
Hgene | CYP2E1 | GO:0002933 | lipid hydroxylation | 10553002 |
Hgene | CYP2E1 | GO:0016098 | monoterpenoid metabolic process | 16401082 |
Hgene | CYP2E1 | GO:0017144 | drug metabolic process | 19219744 |
Hgene | CYP2E1 | GO:0018960 | 4-nitrophenol metabolic process | 9348445 |
Hgene | CYP2E1 | GO:0046483 | heterocycle metabolic process | 19651758 |
Hgene | CYP2E1 | GO:0055114 | oxidation-reduction process | 16401082|19219744 |
![]() * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
![]() |
![]() * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
![]() |
Top |
Fusion Gene Sample Information |
![]() |
![]() * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
ChimerDB4 | LIHC | TCGA-DD-A4NP-01A | CYP2E1 | chr10 | 135341076 | + | REG3A | chr2 | 79384824 | - |
Top |
Fusion ORF Analysis |
![]() |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
ENST00000463117 | CYP2E1 | chr10 | 135341076 | + | ENST00000409839 | REG3A | chr2 | 79384824 | - | 864 | 449 | 200 | 643 | 147 |
ENST00000463117 | CYP2E1 | chr10 | 135341076 | + | ENST00000393878 | REG3A | chr2 | 79384824 | - | 863 | 449 | 200 | 643 | 147 |
ENST00000463117 | CYP2E1 | chr10 | 135341076 | + | ENST00000305165 | REG3A | chr2 | 79384824 | - | 778 | 449 | 200 | 643 | 147 |
ENST00000252945 | CYP2E1 | chr10 | 135341076 | + | ENST00000409839 | REG3A | chr2 | 79384824 | - | 625 | 210 | 33 | 404 | 123 |
ENST00000252945 | CYP2E1 | chr10 | 135341076 | + | ENST00000393878 | REG3A | chr2 | 79384824 | - | 624 | 210 | 33 | 404 | 123 |
ENST00000252945 | CYP2E1 | chr10 | 135341076 | + | ENST00000305165 | REG3A | chr2 | 79384824 | - | 539 | 210 | 33 | 404 | 123 |
![]() |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
ENST00000463117 | ENST00000409839 | CYP2E1 | chr10 | 135341076 | + | REG3A | chr2 | 79384824 | - | 0.75582236 | 0.24417767 |
ENST00000463117 | ENST00000393878 | CYP2E1 | chr10 | 135341076 | + | REG3A | chr2 | 79384824 | - | 0.7680964 | 0.23190366 |
ENST00000463117 | ENST00000305165 | CYP2E1 | chr10 | 135341076 | + | REG3A | chr2 | 79384824 | - | 0.61413765 | 0.38586238 |
ENST00000252945 | ENST00000409839 | CYP2E1 | chr10 | 135341076 | + | REG3A | chr2 | 79384824 | - | 0.78191125 | 0.2180888 |
ENST00000252945 | ENST00000393878 | CYP2E1 | chr10 | 135341076 | + | REG3A | chr2 | 79384824 | - | 0.7876355 | 0.21236454 |
ENST00000252945 | ENST00000305165 | CYP2E1 | chr10 | 135341076 | + | REG3A | chr2 | 79384824 | - | 0.6053502 | 0.3946498 |
Top |
Fusion Amino Acid Sequences |
![]() |
>FusionGDB ID_FusionGDB isoform ID_FGname_Hgene_Hchr_Hbp_Henst_Tgene_Tchr_Tbp_Tenst_length(fusion AA) seq_BP >21063_21063_1_CYP2E1-REG3A_CYP2E1_chr10_135341076_ENST00000252945_REG3A_chr2_79384824_ENST00000305165_length(amino acids)=123AA_BP=59 MSALGVTVALLVWAAFLLLVSMWRQVHSSWNLPPGPFPLPIIGNLFQLELKNIPKSFTRGTEPNGEGWEWSSSDVMNYFAWERNPSTISS -------------------------------------------------------------- >21063_21063_2_CYP2E1-REG3A_CYP2E1_chr10_135341076_ENST00000252945_REG3A_chr2_79384824_ENST00000393878_length(amino acids)=123AA_BP=59 MSALGVTVALLVWAAFLLLVSMWRQVHSSWNLPPGPFPLPIIGNLFQLELKNIPKSFTRGTEPNGEGWEWSSSDVMNYFAWERNPSTISS -------------------------------------------------------------- >21063_21063_3_CYP2E1-REG3A_CYP2E1_chr10_135341076_ENST00000252945_REG3A_chr2_79384824_ENST00000409839_length(amino acids)=123AA_BP=59 MSALGVTVALLVWAAFLLLVSMWRQVHSSWNLPPGPFPLPIIGNLFQLELKNIPKSFTRGTEPNGEGWEWSSSDVMNYFAWERNPSTISS -------------------------------------------------------------- >21063_21063_4_CYP2E1-REG3A_CYP2E1_chr10_135341076_ENST00000463117_REG3A_chr2_79384824_ENST00000305165_length(amino acids)=147AA_BP=83 MAPFMWQVVIQDCLPGWQQGPSGTMSALGVTVALLVWAAFLLLVSMWRQVHSSWNLPPGPFPLPIIGNLFQLELKNIPKSFTRGTEPNGE -------------------------------------------------------------- >21063_21063_5_CYP2E1-REG3A_CYP2E1_chr10_135341076_ENST00000463117_REG3A_chr2_79384824_ENST00000393878_length(amino acids)=147AA_BP=83 MAPFMWQVVIQDCLPGWQQGPSGTMSALGVTVALLVWAAFLLLVSMWRQVHSSWNLPPGPFPLPIIGNLFQLELKNIPKSFTRGTEPNGE -------------------------------------------------------------- >21063_21063_6_CYP2E1-REG3A_CYP2E1_chr10_135341076_ENST00000463117_REG3A_chr2_79384824_ENST00000409839_length(amino acids)=147AA_BP=83 MAPFMWQVVIQDCLPGWQQGPSGTMSALGVTVALLVWAAFLLLVSMWRQVHSSWNLPPGPFPLPIIGNLFQLELKNIPKSFTRGTEPNGE -------------------------------------------------------------- |
Top |
Fusion Protein Functional Features |
![]() Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr10:135341076/chr2:79384824) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
![]() |
![]() |
Hgene | Tgene |
CYP2E1 | . |
FUNCTION: A cytochrome P450 monooxygenase involved in the metabolism of fatty acids (PubMed:10553002, PubMed:18577768). Mechanistically, uses molecular oxygen inserting one oxygen atom into a substrate, and reducing the second into a water molecule, with two electrons provided by NADPH via cytochrome P450 reductase (NADPH--hemoprotein reductase) (PubMed:10553002, PubMed:18577768). Catalyzes the hydroxylation of carbon-hydrogen bonds. Hydroxylates fatty acids specifically at the omega-1 position displaying the highest catalytic activity for saturated fatty acids (PubMed:10553002, PubMed:18577768). May be involved in the oxidative metabolism of xenobiotics (Probable). {ECO:0000269|PubMed:10553002, ECO:0000269|PubMed:18577768, ECO:0000305|PubMed:9348445}. | FUNCTION: Might normally function as a transcriptional repressor. EWS-fusion-proteins (EFPS) may play a role in the tumorigenic process. They may disturb gene expression by mimicking, or interfering with the normal function of CTD-POLII within the transcription initiation complex. They may also contribute to an aberrant activation of the fusion protein target genes. |
![]() |
- Retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
- Not-retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Hgene | CYP2E1 | chr10:135341076 | chr2:79384824 | ENST00000252945 | + | 1 | 9 | 298_303 | 59.0 | 494.0 | Region | Substrate binding |
Hgene | CYP2E1 | chr10:135341076 | chr2:79384824 | ENST00000463117 | + | 3 | 11 | 298_303 | 59.0 | 494.0 | Region | Substrate binding |
Tgene | REG3A | chr10:135341076 | chr2:79384824 | ENST00000305165 | 3 | 6 | 47_172 | 111.0 | 176.0 | Domain | C-type lectin | |
Tgene | REG3A | chr10:135341076 | chr2:79384824 | ENST00000393878 | 2 | 5 | 47_172 | 111.0 | 176.0 | Domain | C-type lectin | |
Tgene | REG3A | chr10:135341076 | chr2:79384824 | ENST00000409839 | 3 | 6 | 47_172 | 111.0 | 176.0 | Domain | C-type lectin |
Top |
Fusion Protein-Protein Interaction |
![]() |
![]() |
Gene | PPI interactors |
![]() |
Gene | STRING network |
CYP2E1 | |
REG3A |
![]() |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
![]() |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
Related Drugs to CYP2E1-REG3A |
![]() (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Drug | Source | PMID |
Top |
Related Diseases to CYP2E1-REG3A |
![]() (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Disease | Source | PMID |
![]() (DisGeNet 4.0) |
Partner | Gene | Disease ID | Disease name | # pubmeds | Source |