| UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
|
|||||||
|
Fusion Protein:CYP4A11-CYP4F3 |
Fusion Protein Summary |
 Fusion gene summary |
| Fusion partner gene information | Fusion gene name: CYP4A11-CYP4F3 | FusionPDB ID: 21080 | FusionGDB2.0 ID: 21080 | Hgene | Tgene | Gene symbol | CYP4A11 | CYP4F3 | Gene ID | 1579 | 4051 |
| Gene name | cytochrome P450 family 4 subfamily A member 11 | cytochrome P450 family 4 subfamily F member 3 | |
| Synonyms | CP4Y|CYP4A2|CYP4AII|CYPIVA11 | CPF3|CYP4F|CYPIVF3|LTB4H | |
| Cytomap | 1p33 | 19p13.12 | |
| Type of gene | protein-coding | protein-coding | |
| Description | cytochrome P450 4A1120-HETE synthase20-hydroxyeicosatetraenoic acid synthaseP450HL-omegaalkane-1 monooxygenasecytochrome P-450HK-omegacytochrome P450, family 4, subfamily A, polypeptide 11cytochrome P450, subfamily IVA, polypeptide 11cytochrome P4 | cytochrome P450 4F320-HETE synthase20-hydroxyeicosatetraenoic acid synthasecytochrome P-450cytochrome P450, family 4, subfamily F, polypeptide 3cytochrome P450, subfamily IVF, polypeptide 3 (leukotriene B4 omega hydroxylase)cytochrome P450-LTB-omega | |
| Modification date | 20200313 | 20200313 | |
| UniProtAcc | Q02928 | Q08477 | |
| Ensembl transtripts involved in fusion gene | ENST ids | ENST00000310638, ENST00000371904, ENST00000371905, ENST00000457840, ENST00000462347, ENST00000496519, | ENST00000588886, ENST00000221307, ENST00000585846, ENST00000586182, ENST00000591058, |
| Fusion gene scores for assessment (based on all fusion genes of FusionGDB 2.0) | * DoF score | 3 X 3 X 2=18 | 4 X 4 X 4=64 |
| # samples | 3 | 4 | |
| ** MAII score | log2(3/18*10)=0.736965594166206 effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs). DoF>8 and MAII>0 | log2(4/64*10)=-0.678071905112638 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | |
| Context (manual curation of fusion genes in FusionPDB) | PubMed: CYP4A11 [Title/Abstract] AND CYP4F3 [Title/Abstract] AND fusion [Title/Abstract] | ||
| Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) | CYP4A11(47400124)-CYP4F3(15763632), # samples:1 | ||
| Anticipated loss of major functional domain due to fusion event. | CYP4A11-CYP4F3 seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. CYP4A11-CYP4F3 seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. CYP4A11-CYP4F3 seems lost the major protein functional domain in Hgene partner, which is a IUPHAR drug target due to the frame-shifted ORF. CYP4A11-CYP4F3 seems lost the major protein functional domain in Tgene partner, which is a IUPHAR drug target due to the frame-shifted ORF. | ||
| * DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
| Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Partner | Gene | GO ID | GO term | PubMed ID |
| Hgene | CYP4A11 | GO:0001676 | long-chain fatty acid metabolic process | 18433732 |
| Hgene | CYP4A11 | GO:0006691 | leukotriene metabolic process | 9799565 |
| Hgene | CYP4A11 | GO:0019369 | arachidonic acid metabolic process | 10660572 |
| Hgene | CYP4A11 | GO:0019373 | epoxygenase P450 pathway | 9618440 |
| Hgene | CYP4A11 | GO:0055114 | oxidation-reduction process | 9618440|9799565|18433732 |
| Fusion gene breakpoints across CYP4A11 (5'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
 |
| Fusion gene breakpoints across CYP4F3 (3'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
 |
Top |
Fusion Gene Sample Information |
| Fusion gene information from FusionGDB2.0. |
| Fusion gene information from two resources (ChiTars 5.0 and ChimerDB 4.0) * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
| Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
| ChimerDB4 | Non-Cancer | TCGA-BQ-5879-11A | CYP4A11 | chr1 | 47400124 | - | CYP4F3 | chr19 | 15763632 | + |
Top |
Fusion ORF Analysis |
| Fusion information from ORFfinder translation from full-length transcript sequence from FusionPDB. |
| Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
| ENST00000462347 | CYP4A11 | chr1 | 47400124 | - | ENST00000586182 | CYP4F3 | chr19 | 15763632 | + | 2092 | 773 | 31 | 1350 | 439 |
| ENST00000462347 | CYP4A11 | chr1 | 47400124 | - | ENST00000591058 | CYP4F3 | chr19 | 15763632 | + | 2724 | 773 | 31 | 1350 | 439 |
| ENST00000462347 | CYP4A11 | chr1 | 47400124 | - | ENST00000221307 | CYP4F3 | chr19 | 15763632 | + | 4791 | 773 | 31 | 1350 | 439 |
| ENST00000462347 | CYP4A11 | chr1 | 47400124 | - | ENST00000585846 | CYP4F3 | chr19 | 15763632 | + | 1737 | 773 | 31 | 1350 | 439 |
| DeepORF prediction of the coding potential based on the fusion transcript sequence of in-frame fusion genes. DeepORF is a coding potential classifier based on convolutional neural network by comparing the real Ribo-seq data. If the no-coding score < 0.5 and coding score > 0.5, then the in-frame fusion transcript is predicted as being likely translated. |
| Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
| ENST00000462347 | ENST00000586182 | CYP4A11 | chr1 | 47400124 | - | CYP4F3 | chr19 | 15763632 | + | 0.06931838 | 0.93068165 |
| ENST00000462347 | ENST00000591058 | CYP4A11 | chr1 | 47400124 | - | CYP4F3 | chr19 | 15763632 | + | 0.031760946 | 0.968239 |
| ENST00000462347 | ENST00000221307 | CYP4A11 | chr1 | 47400124 | - | CYP4F3 | chr19 | 15763632 | + | 0.007139117 | 0.99286085 |
| ENST00000462347 | ENST00000585846 | CYP4A11 | chr1 | 47400124 | - | CYP4F3 | chr19 | 15763632 | + | 0.09432569 | 0.9056743 |
Top |
Fusion Amino Acid Sequences |
| For individual full-length fusion transcript sequence from FusionPDB, we ran ORFfinder and chose the longest ORF among the all predicted ones. |
| >FusionGDB ID_FusionGDB isoform ID_FGname_Hgene_Hchr_Hbp_Henst_Tgene_Tchr_Tbp_Tenst_length(fusion AA) seq_BP >21080_21080_1_CYP4A11-CYP4F3_CYP4A11_chr1_47400124_ENST00000462347_CYP4F3_chr19_15763632_ENST00000221307_length(amino acids)=439AA_BP=127 MSVSVLSPSRLLGDVSGILQAASLLILLLLLIKAVQLYLHRQWLLKALQQFPCPPSHWLFGHIQELQQDQELQRIQKWVETFPSACPHWL WGGKVRVQLYDPDYMKVILGRSDPKSHGSYRFLAPWIGYGLLLLNGQTWFQHRRMLTPAFHYDILKPYVGLMADSVRVMLDKWEELLGQD SPLEVFQHVSLMTLDTIMKCAFSHQGSIQVDRPSDPTEEGSTTEGGGAGEDQEEEAFGFSGYPPLGQSHDTTASGLSWVLYHLAKHPEYQ ERCRQEVQELLKDREPKEIEWDDLAQLPFLTMCIKESLRLHPPVPAVSRCCTQDIVLPDGRVIPKGIICLISVFGTHHNPAVWPDPEVYD -------------------------------------------------------------- >21080_21080_2_CYP4A11-CYP4F3_CYP4A11_chr1_47400124_ENST00000462347_CYP4F3_chr19_15763632_ENST00000585846_length(amino acids)=439AA_BP=127 MSVSVLSPSRLLGDVSGILQAASLLILLLLLIKAVQLYLHRQWLLKALQQFPCPPSHWLFGHIQELQQDQELQRIQKWVETFPSACPHWL WGGKVRVQLYDPDYMKVILGRSDPKSHGSYRFLAPWIGYGLLLLNGQTWFQHRRMLTPAFHYDILKPYVGLMADSVRVMLDKWEELLGQD SPLEVFQHVSLMTLDTIMKCAFSHQGSIQVDRPSDPTEEGSTTEGGGAGEDQEEEAFGFSGYPPLGQSHDTTASGLSWVLYHLAKHPEYQ ERCRQEVQELLKDREPKEIEWDDLAQLPFLTMCIKESLRLHPPVPAVSRCCTQDIVLPDGRVIPKGIICLISVFGTHHNPAVWPDPEVYD -------------------------------------------------------------- >21080_21080_3_CYP4A11-CYP4F3_CYP4A11_chr1_47400124_ENST00000462347_CYP4F3_chr19_15763632_ENST00000586182_length(amino acids)=439AA_BP=127 MSVSVLSPSRLLGDVSGILQAASLLILLLLLIKAVQLYLHRQWLLKALQQFPCPPSHWLFGHIQELQQDQELQRIQKWVETFPSACPHWL WGGKVRVQLYDPDYMKVILGRSDPKSHGSYRFLAPWIGYGLLLLNGQTWFQHRRMLTPAFHYDILKPYVGLMADSVRVMLDKWEELLGQD SPLEVFQHVSLMTLDTIMKCAFSHQGSIQVDRPSDPTEEGSTTEGGGAGEDQEEEAFGFSGYPPLGQSHDTTASGLSWVLYHLAKHPEYQ ERCRQEVQELLKDREPKEIEWDDLAQLPFLTMCIKESLRLHPPVPAVSRCCTQDIVLPDGRVIPKGIICLISVFGTHHNPAVWPDPEVYD -------------------------------------------------------------- >21080_21080_4_CYP4A11-CYP4F3_CYP4A11_chr1_47400124_ENST00000462347_CYP4F3_chr19_15763632_ENST00000591058_length(amino acids)=439AA_BP=127 MSVSVLSPSRLLGDVSGILQAASLLILLLLLIKAVQLYLHRQWLLKALQQFPCPPSHWLFGHIQELQQDQELQRIQKWVETFPSACPHWL WGGKVRVQLYDPDYMKVILGRSDPKSHGSYRFLAPWIGYGLLLLNGQTWFQHRRMLTPAFHYDILKPYVGLMADSVRVMLDKWEELLGQD SPLEVFQHVSLMTLDTIMKCAFSHQGSIQVDRPSDPTEEGSTTEGGGAGEDQEEEAFGFSGYPPLGQSHDTTASGLSWVLYHLAKHPEYQ ERCRQEVQELLKDREPKEIEWDDLAQLPFLTMCIKESLRLHPPVPAVSRCCTQDIVLPDGRVIPKGIICLISVFGTHHNPAVWPDPEVYD -------------------------------------------------------------- |
Top |
Fusion Protein Functional Features |
| Four levels of functional features of fusion genes Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr1:47400124/chr19:15763632) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
 |
| Main function of each fusion partner protein. (from UniProt) |
| Hgene | Tgene |
| CYP4A11 | CYP4F3 |
| FUNCTION: A cytochrome P450 monooxygenase involved in the metabolism of fatty acids and their oxygenated derivatives (oxylipins) (PubMed:7679927, PubMed:1739747, PubMed:8914854, PubMed:10553002, PubMed:10660572, PubMed:15611369). Mechanistically, uses molecular oxygen inserting one oxygen atom into a substrate, and reducing the second into a water molecule, with two electrons provided by NADPH via cytochrome P450 reductase (CPR; NADPH-ferrihemoprotein reductase) (PubMed:7679927, PubMed:1739747, PubMed:8914854, PubMed:10553002, PubMed:10660572, PubMed:15611369). Catalyzes predominantly the oxidation of the terminal carbon (omega-oxidation) of saturated and unsaturated fatty acids, the catalytic efficiency decreasing in the following order: dodecanoic > tetradecanoic > (9Z)-octadecenoic > (9Z,12Z)-octadecadienoic > hexadecanoic acid (PubMed:10553002, PubMed:10660572). Acts as a major omega-hydroxylase for dodecanoic (lauric) acid in liver (PubMed:7679927, PubMed:1739747, PubMed:8914854, PubMed:15611369). Participates in omega-hydroxylation of (5Z,8Z,11Z,14Z)-eicosatetraenoic acid (arachidonate) to 20-hydroxyeicosatetraenoic acid (20-HETE), a signaling molecule acting both as vasoconstrictive and natriuretic with overall effect on arterial blood pressure (PubMed:10620324, PubMed:10660572, PubMed:15611369). Can also catalyze the oxidation of the penultimate carbon (omega-1 oxidation) of fatty acids with lower efficiency (PubMed:7679927). May contribute to the degradation of saturated very long-chain fatty acids (VLCFAs) such as docosanoic acid, by catalyzing successive omega-oxidations to the corresponding dicarboxylic acid, thereby initiating chain shortening (PubMed:18182499). Omega-hydroxylates (9R,10S)-epoxy-octadecanoate stereoisomer (PubMed:15145985). Plays a minor role in omega-oxidation of long-chain 3-hydroxy fatty acids (PubMed:18065749). Has little activity toward prostaglandins A1 and E1 (PubMed:7679927). {ECO:0000269|PubMed:10553002, ECO:0000269|PubMed:10620324, ECO:0000269|PubMed:10660572, ECO:0000269|PubMed:15145985, ECO:0000269|PubMed:15611369, ECO:0000269|PubMed:1739747, ECO:0000269|PubMed:18065749, ECO:0000269|PubMed:18182499, ECO:0000269|PubMed:7679927, ECO:0000269|PubMed:8914854}. | FUNCTION: A cytochrome P450 monooxygenase involved in the metabolism of various endogenous substrates, including fatty acids and their oxygenated derivatives (oxylipins) (PubMed:8486631, PubMed:9675028, PubMed:11461919, PubMed:15145985, PubMed:16547005, PubMed:16820285, PubMed:18182499, PubMed:18065749, PubMed:18577768). Mechanistically, uses molecular oxygen inserting one oxygen atom into a substrate, and reducing the second into a water molecule, with two electrons provided by NADPH via cytochrome P450 reductase (CPR; NADPH-ferrihemoprotein reductase) (PubMed:9675028). May play a role in inactivation of proinflammatory and anti-inflammatory oxylipins during the resolution of inflammation (PubMed:8486631, PubMed:9675028, PubMed:11461919, PubMed:15145985, PubMed:15364545, PubMed:16547005, PubMed:16820285, PubMed:18182499, PubMed:18065749, PubMed:18577768). {ECO:0000269|PubMed:11461919, ECO:0000269|PubMed:15145985, ECO:0000269|PubMed:15364545, ECO:0000269|PubMed:16547005, ECO:0000269|PubMed:16820285, ECO:0000269|PubMed:18065749, ECO:0000269|PubMed:18182499, ECO:0000269|PubMed:18577768, ECO:0000269|PubMed:8486631, ECO:0000269|PubMed:9675028}.; FUNCTION: [Isoform CYP4F3A]: Catalyzes predominantly the oxidation of the terminal carbon (omega-oxidation) of oxylipins in myeloid cells, displaying higher affinity for arachidonate metabolite leukotriene B4 (LTB4) (PubMed:8486631, PubMed:9675028, PubMed:11461919, PubMed:15364545). Inactivates LTB4 via three successive oxidative transformations to 20-hydroxy-LTB4, then to 20-oxo-LTB4 and to 20-carboxy-LTB4 (PubMed:9675028). Has omega-hydroxylase activity toward long-chain fatty acid epoxides with preference for 8,9-epoxy-(5Z,11Z,14Z)-eicosatrienoate (EET) and 9,10-epoxyoctadecanoate (PubMed:15145985). Omega-hydroxylates monohydroxy polyunsaturated fatty acids (PUFAs), including hydroxyeicosatetraenoates (HETEs) and hydroxyeicosapentaenoates (HEPEs), to dihydroxy compounds (PubMed:15364545, PubMed:9675028). Contributes to the degradation of saturated very long-chain fatty acids (VLCFAs) such as docosanoic acid, by catalyzing successive omega-oxidations to the corresponding dicarboxylic acid, thereby initiating chain shortening (PubMed:18182499). Has low hydroxylase activity toward PUFAs (PubMed:18577768, PubMed:11461919). {ECO:0000269|PubMed:11461919, ECO:0000269|PubMed:15145985, ECO:0000269|PubMed:15364545, ECO:0000269|PubMed:18182499, ECO:0000269|PubMed:18577768, ECO:0000269|PubMed:8486631, ECO:0000269|PubMed:9675028}.; FUNCTION: [Isoform CYP4F3B]: Catalyzes predominantly the oxidation of the terminal carbon (omega-oxidation) of polyunsaturated fatty acids (PUFAs) (PubMed:11461919, PubMed:16820285, PubMed:18577768). Participates in the conversion of arachidonic acid to 20-hydroxyeicosatetraenoic acid (20-HETE), a signaling molecule acting both as vasoconstrictive and natriuretic with overall effect on arterial blood pressure (PubMed:11461919, PubMed:16820285, PubMed:18577768). Has high omega-hydroxylase activity toward other PUFAs, including eicosatrienoic acid (ETA), eicosapentaenoic acid (EPA) and docosahexaenoic acid (DHA) (PubMed:16820285, PubMed:18577768). Can also catalyze the oxidation of the penultimate carbon (omega-1 oxidation) of PUFAs with lower efficiency (PubMed:18577768). Contributes to the degradation of saturated very long-chain fatty acids (VLCFAs) such as docosanoic acid and hexacosanoic acid, by catalyzing successive omega-oxidations to the corresponding dicarboxylic acids, thereby initiating chain shortening (PubMed:16547005, PubMed:18182499). Omega-hydroxylates long-chain 3-hydroxy fatty acids, likely initiating the oxidative conversion to the corresponding 3-hydroxydicarboxylic fatty acids (PubMed:18065749). Has omega-hydroxylase activity toward long-chain fatty acid epoxides with preference for 8,9-epoxy-(5Z,11Z,14Z)-eicosatrienoate (EET) and 9,10-epoxyoctadecanoate (PubMed:15145985). {ECO:0000269|PubMed:11461919, ECO:0000269|PubMed:15145985, ECO:0000269|PubMed:16547005, ECO:0000269|PubMed:16820285, ECO:0000269|PubMed:18065749, ECO:0000269|PubMed:18182499, ECO:0000269|PubMed:18577768}. |
| Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
| - Retained protein feature among the 13 regional features. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
| Hgene | CYP4A11 | chr1:47400124 | chr19:15763632 | ENST00000310638 | - | 7 | 12 | 131_134 | 299.0 | 520.0 | Compositional bias | Note=Poly-Leu |
| Hgene | CYP4A11 | chr1:47400124 | chr19:15763632 | ENST00000310638 | - | 7 | 12 | 24_31 | 299.0 | 520.0 | Compositional bias | Note=Poly-Leu |
| Hgene | CYP4A11 | chr1:47400124 | chr19:15763632 | ENST00000371905 | - | 7 | 11 | 131_134 | 299.0 | 456.0 | Compositional bias | Note=Poly-Leu |
| Hgene | CYP4A11 | chr1:47400124 | chr19:15763632 | ENST00000371905 | - | 7 | 11 | 24_31 | 299.0 | 456.0 | Compositional bias | Note=Poly-Leu |
| - Not-retained protein feature among the 13 regional features. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
| Tgene | CYP4F3 | chr1:47400124 | chr19:15763632 | ENST00000221307 | 7 | 13 | 11_31 | 328.3333333333333 | 521.0 | Transmembrane | Helical | |
| Tgene | CYP4F3 | chr1:47400124 | chr19:15763632 | ENST00000585846 | 6 | 12 | 11_31 | 328.3333333333333 | 521.0 | Transmembrane | Helical | |
| Tgene | CYP4F3 | chr1:47400124 | chr19:15763632 | ENST00000586182 | 7 | 13 | 11_31 | 328.3333333333333 | 521.0 | Transmembrane | Helical | |
| Tgene | CYP4F3 | chr1:47400124 | chr19:15763632 | ENST00000591058 | 7 | 13 | 11_31 | 328.3333333333333 | 521.0 | Transmembrane | Helical |
Top |
Fusion Protein-Protein Interaction |
| Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in |
| Protein-protein interactors with each fusion partner protein in wild-type from validated records (BIOGRID-3.4.160) |
| Gene | PPI interactors |
| Protein-protein interactors based on sequence similarity (STRING) |
| Gene | STRING network |
| CYP4A11 | |
| CYP4F3 |
| - Retained interactions in fusion protein (protein functional feature from UniProt). |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
| - Lost interactions due to fusion (protein functional feature from UniProt). |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
Related Drugs to CYP4A11-CYP4F3 |
| Drugs used for this fusion-positive patient. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
| Hgene | Tgene | Drug | Source | PMID |
Top |
Related Diseases to CYP4A11-CYP4F3 |
| Diseases that have this fusion gene. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
| Hgene | Tgene | Disease | Source | PMID |
| Diseases associated with fusion partners. (DisGeNet 4.0) |
| Partner | Gene | Disease ID | Disease name | # pubmeds | Source |
Copyright 2021-Present -The University of Texas Health Science Center at Houston (UTHealth)
Web File Viewing | Emergency Information |Campus Carry|Site Policies