UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
![]() |
|||||||
|
Fusion Protein:CYP51A1-KRIT1 |
Fusion Protein Summary |
![]() |
Fusion partner gene information | Fusion gene name: CYP51A1-KRIT1 | FusionPDB ID: 21113 | FusionGDB2.0 ID: 21113 | Hgene | Tgene | Gene symbol | CYP51A1 | KRIT1 | Gene ID | 1595 | 889 |
Gene name | cytochrome P450 family 51 subfamily A member 1 | KRIT1 ankyrin repeat containing | |
Synonyms | CP51|CYP51|CYPL1|LDM|P450-14DM|P450L1 | CAM|CCM1 | |
Cytomap | 7q21.2 | 7q21.2 | |
Type of gene | protein-coding | protein-coding | |
Description | lanosterol 14-alpha demethylaseCYPLIcytochrome P450 51A1cytochrome P450, 51 (lanosterol 14-alpha-demethylase)cytochrome P450, family 51, subfamily A, polypeptide 1cytochrome P450-14DMcytochrome P45014DMcytochrome P450LIsterol 14-alpha demethylase | krev interaction trapped protein 1ankyrin repeat-containing protein Krit1cerebral cavernous malformations 1 proteinkrev interaction trapped 1 | |
Modification date | 20200313 | 20200313 | |
UniProtAcc | Q16850 | O00522 | |
Ensembl transtripts involved in fusion gene | ENST ids | ENST00000003100, ENST00000450723, | ENST00000466166, ENST00000340022, ENST00000394503, ENST00000394505, ENST00000394507, ENST00000412043, |
Fusion gene scores for assessment (based on all fusion genes of FusionGDB 2.0) | * DoF score | 4 X 5 X 4=80 | 3 X 3 X 3=27 |
# samples | 4 | 3 | |
** MAII score | log2(4/80*10)=-1 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | log2(3/27*10)=0.15200309344505 effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs). DoF>8 and MAII>0 | |
Context (manual curation of fusion genes in FusionPDB) | PubMed: CYP51A1 [Title/Abstract] AND KRIT1 [Title/Abstract] AND fusion [Title/Abstract] | ||
Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) | CYP51A1(91755566)-KRIT1(91864960), # samples:1 | ||
Anticipated loss of major functional domain due to fusion event. | CYP51A1-KRIT1 seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. CYP51A1-KRIT1 seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. CYP51A1-KRIT1 seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. CYP51A1-KRIT1 seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. CYP51A1-KRIT1 seems lost the major protein functional domain in Hgene partner, which is a essential gene due to the frame-shifted ORF. CYP51A1-KRIT1 seems lost the major protein functional domain in Hgene partner, which is a IUPHAR drug target due to the frame-shifted ORF. CYP51A1-KRIT1 seems lost the major protein functional domain in Tgene partner, which is a tumor suppressor due to the frame-shifted ORF. |
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
![]() |
Partner | Gene | GO ID | GO term | PubMed ID |
Hgene | CYP51A1 | GO:0006694 | steroid biosynthetic process | 20149798 |
![]() * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
![]() |
![]() * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
![]() |
Top |
Fusion Gene Sample Information |
![]() |
![]() * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
ChimerDB4 | Non-Cancer | 5357N | CYP51A1 | chr7 | 91755566 | - | KRIT1 | chr7 | 91864960 | - |
Top |
Fusion ORF Analysis |
![]() |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
ENST00000003100 | CYP51A1 | chr7 | 91755566 | - | ENST00000394507 | KRIT1 | chr7 | 91864960 | - | 4429 | 936 | 166 | 2661 | 831 |
ENST00000003100 | CYP51A1 | chr7 | 91755566 | - | ENST00000340022 | KRIT1 | chr7 | 91864960 | - | 3985 | 936 | 166 | 2661 | 831 |
ENST00000003100 | CYP51A1 | chr7 | 91755566 | - | ENST00000412043 | KRIT1 | chr7 | 91864960 | - | 3040 | 936 | 166 | 2661 | 831 |
ENST00000003100 | CYP51A1 | chr7 | 91755566 | - | ENST00000394505 | KRIT1 | chr7 | 91864960 | - | 3040 | 936 | 166 | 2661 | 831 |
ENST00000003100 | CYP51A1 | chr7 | 91755566 | - | ENST00000394503 | KRIT1 | chr7 | 91864960 | - | 2881 | 936 | 166 | 2517 | 783 |
![]() |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
ENST00000003100 | ENST00000394507 | CYP51A1 | chr7 | 91755566 | - | KRIT1 | chr7 | 91864960 | - | 0.000120029 | 0.99987996 |
ENST00000003100 | ENST00000340022 | CYP51A1 | chr7 | 91755566 | - | KRIT1 | chr7 | 91864960 | - | 0.000136473 | 0.9998635 |
ENST00000003100 | ENST00000412043 | CYP51A1 | chr7 | 91755566 | - | KRIT1 | chr7 | 91864960 | - | 0.000311928 | 0.99968815 |
ENST00000003100 | ENST00000394505 | CYP51A1 | chr7 | 91755566 | - | KRIT1 | chr7 | 91864960 | - | 0.000311928 | 0.99968815 |
ENST00000003100 | ENST00000394503 | CYP51A1 | chr7 | 91755566 | - | KRIT1 | chr7 | 91864960 | - | 0.000352204 | 0.99964774 |
Top |
Fusion Amino Acid Sequences |
![]() |
>FusionGDB ID_FusionGDB isoform ID_FGname_Hgene_Hchr_Hbp_Henst_Tgene_Tchr_Tbp_Tenst_length(fusion AA) seq_BP >21113_21113_1_CYP51A1-KRIT1_CYP51A1_chr7_91755566_ENST00000003100_KRIT1_chr7_91864960_ENST00000340022_length(amino acids)=831AA_BP=256 MAAAAGMLLLGLLQAGGSVLGQAMEKVTGGNLLSMLLIACAFTLSLVYLIRLAAGHLVQLPAGVKSPPYIFSPIPFLGHAIAFGKSPIEF LENAYEKYGPVFSFTMVGKTFTYLLGSDAAALLFNSKNEDLNAEDVYSRLTTPVFGKGVAYDVPNPVFLEQKKMLKSGLNIAHFKQHVSI IEKETKEYFESWGESGEKNVFEALSELIILTASHCLHGKEIRSQLNEKVAQLYADLDGGFSHAAWLLPGWLPLPSFRWLDERHAQSHFIP ALFRPSPLERIKTNVINPAYATESGQTENSLHMGYSALEIKSKMLALEKADTCIYNPLFGSDLQYTNRVDKVVINPYFGLGAPDYSKIQI PKQEKWQRSMSSVTEDKERQWVDDFPLHRSACEGDSELLSRLLSERFSVNQLDSDHWAPIHYACWYGKVEATRILLEKGKCNPNLLNGQL SSPLHFAAGGGHAEIVQILLNHPETDRHITDQQGRSPLNICEENKQNNWEEAAKLLKEAINKPYEKVRIYRMDGSYRSVELKHGNNTTVQ QIMEGMRLSQETQQYFTIWICSENLSLQLKPYHKPLQHVRDWPEILAELTNLDPQRETPQLFLRRDVRLPLEVEKQIEDPLAILILFDEA RYNLLKGFYTAPDAKLITLASLLLQIVYGNYESKKHKQGFLNEENLKSIVPVTKLKSKAPHWTNRILHEYKNLSTSEGVSKEMHHLQRMF LQNCWEIPTYGAAFFTGQIFTKASPSNHKVIPVYVGVNIKGLHLLNMETKALLISLKYGCFMWQLGDTDTCFQIHSMENKMSFIVHTKQA -------------------------------------------------------------- >21113_21113_2_CYP51A1-KRIT1_CYP51A1_chr7_91755566_ENST00000003100_KRIT1_chr7_91864960_ENST00000394503_length(amino acids)=783AA_BP=256 MAAAAGMLLLGLLQAGGSVLGQAMEKVTGGNLLSMLLIACAFTLSLVYLIRLAAGHLVQLPAGVKSPPYIFSPIPFLGHAIAFGKSPIEF LENAYEKYGPVFSFTMVGKTFTYLLGSDAAALLFNSKNEDLNAEDVYSRLTTPVFGKGVAYDVPNPVFLEQKKMLKSGLNIAHFKQHVSI IEKETKEYFESWGESGEKNVFEALSELIILTASHCLHGKEIRSQLNEKVAQLYADLDGGFSHAAWLLPGWLPLPSFRWLDERHAQSHFIP ALFRPSPLERIKTNVINPAYATESGQTENSLHMGYSALEIKSKMLALEKADTCIYNPLFGSDLQYTNRVDKVVINPYFGLGAPDYSKIQI PKQEKWQRSMSSVTEDKYGKVEATRILLEKGKCNPNLLNGQLSSPLHFAAGGGHAEIVQILLNHPETDRHITDQQGRSPLNICEENKQNN WEEAAKLLKEAINKPYEKVRIYRMDGSYRSVELKHGNNTTVQQIMEGMRLSQETQQYFTIWICSENLSLQLKPYHKPLQHVRDWPEILAE LTNLDPQRETPQLFLRRDVRLPLEVEKQIEDPLAILILFDEARYNLLKGFYTAPDAKLITLASLLLQIVYGNYESKKHKQGFLNEENLKS IVPVTKLKSKAPHWTNRILHEYKNLSTSEGVSKEMHHLQRMFLQNCWEIPTYGAAFFTGQIFTKASPSNHKVIPVYVGVNIKGLHLLNME -------------------------------------------------------------- >21113_21113_3_CYP51A1-KRIT1_CYP51A1_chr7_91755566_ENST00000003100_KRIT1_chr7_91864960_ENST00000394505_length(amino acids)=831AA_BP=256 MAAAAGMLLLGLLQAGGSVLGQAMEKVTGGNLLSMLLIACAFTLSLVYLIRLAAGHLVQLPAGVKSPPYIFSPIPFLGHAIAFGKSPIEF LENAYEKYGPVFSFTMVGKTFTYLLGSDAAALLFNSKNEDLNAEDVYSRLTTPVFGKGVAYDVPNPVFLEQKKMLKSGLNIAHFKQHVSI IEKETKEYFESWGESGEKNVFEALSELIILTASHCLHGKEIRSQLNEKVAQLYADLDGGFSHAAWLLPGWLPLPSFRWLDERHAQSHFIP ALFRPSPLERIKTNVINPAYATESGQTENSLHMGYSALEIKSKMLALEKADTCIYNPLFGSDLQYTNRVDKVVINPYFGLGAPDYSKIQI PKQEKWQRSMSSVTEDKERQWVDDFPLHRSACEGDSELLSRLLSERFSVNQLDSDHWAPIHYACWYGKVEATRILLEKGKCNPNLLNGQL SSPLHFAAGGGHAEIVQILLNHPETDRHITDQQGRSPLNICEENKQNNWEEAAKLLKEAINKPYEKVRIYRMDGSYRSVELKHGNNTTVQ QIMEGMRLSQETQQYFTIWICSENLSLQLKPYHKPLQHVRDWPEILAELTNLDPQRETPQLFLRRDVRLPLEVEKQIEDPLAILILFDEA RYNLLKGFYTAPDAKLITLASLLLQIVYGNYESKKHKQGFLNEENLKSIVPVTKLKSKAPHWTNRILHEYKNLSTSEGVSKEMHHLQRMF LQNCWEIPTYGAAFFTGQIFTKASPSNHKVIPVYVGVNIKGLHLLNMETKALLISLKYGCFMWQLGDTDTCFQIHSMENKMSFIVHTKQA -------------------------------------------------------------- >21113_21113_4_CYP51A1-KRIT1_CYP51A1_chr7_91755566_ENST00000003100_KRIT1_chr7_91864960_ENST00000394507_length(amino acids)=831AA_BP=256 MAAAAGMLLLGLLQAGGSVLGQAMEKVTGGNLLSMLLIACAFTLSLVYLIRLAAGHLVQLPAGVKSPPYIFSPIPFLGHAIAFGKSPIEF LENAYEKYGPVFSFTMVGKTFTYLLGSDAAALLFNSKNEDLNAEDVYSRLTTPVFGKGVAYDVPNPVFLEQKKMLKSGLNIAHFKQHVSI IEKETKEYFESWGESGEKNVFEALSELIILTASHCLHGKEIRSQLNEKVAQLYADLDGGFSHAAWLLPGWLPLPSFRWLDERHAQSHFIP ALFRPSPLERIKTNVINPAYATESGQTENSLHMGYSALEIKSKMLALEKADTCIYNPLFGSDLQYTNRVDKVVINPYFGLGAPDYSKIQI PKQEKWQRSMSSVTEDKERQWVDDFPLHRSACEGDSELLSRLLSERFSVNQLDSDHWAPIHYACWYGKVEATRILLEKGKCNPNLLNGQL SSPLHFAAGGGHAEIVQILLNHPETDRHITDQQGRSPLNICEENKQNNWEEAAKLLKEAINKPYEKVRIYRMDGSYRSVELKHGNNTTVQ QIMEGMRLSQETQQYFTIWICSENLSLQLKPYHKPLQHVRDWPEILAELTNLDPQRETPQLFLRRDVRLPLEVEKQIEDPLAILILFDEA RYNLLKGFYTAPDAKLITLASLLLQIVYGNYESKKHKQGFLNEENLKSIVPVTKLKSKAPHWTNRILHEYKNLSTSEGVSKEMHHLQRMF LQNCWEIPTYGAAFFTGQIFTKASPSNHKVIPVYVGVNIKGLHLLNMETKALLISLKYGCFMWQLGDTDTCFQIHSMENKMSFIVHTKQA -------------------------------------------------------------- >21113_21113_5_CYP51A1-KRIT1_CYP51A1_chr7_91755566_ENST00000003100_KRIT1_chr7_91864960_ENST00000412043_length(amino acids)=831AA_BP=256 MAAAAGMLLLGLLQAGGSVLGQAMEKVTGGNLLSMLLIACAFTLSLVYLIRLAAGHLVQLPAGVKSPPYIFSPIPFLGHAIAFGKSPIEF LENAYEKYGPVFSFTMVGKTFTYLLGSDAAALLFNSKNEDLNAEDVYSRLTTPVFGKGVAYDVPNPVFLEQKKMLKSGLNIAHFKQHVSI IEKETKEYFESWGESGEKNVFEALSELIILTASHCLHGKEIRSQLNEKVAQLYADLDGGFSHAAWLLPGWLPLPSFRWLDERHAQSHFIP ALFRPSPLERIKTNVINPAYATESGQTENSLHMGYSALEIKSKMLALEKADTCIYNPLFGSDLQYTNRVDKVVINPYFGLGAPDYSKIQI PKQEKWQRSMSSVTEDKERQWVDDFPLHRSACEGDSELLSRLLSERFSVNQLDSDHWAPIHYACWYGKVEATRILLEKGKCNPNLLNGQL SSPLHFAAGGGHAEIVQILLNHPETDRHITDQQGRSPLNICEENKQNNWEEAAKLLKEAINKPYEKVRIYRMDGSYRSVELKHGNNTTVQ QIMEGMRLSQETQQYFTIWICSENLSLQLKPYHKPLQHVRDWPEILAELTNLDPQRETPQLFLRRDVRLPLEVEKQIEDPLAILILFDEA RYNLLKGFYTAPDAKLITLASLLLQIVYGNYESKKHKQGFLNEENLKSIVPVTKLKSKAPHWTNRILHEYKNLSTSEGVSKEMHHLQRMF LQNCWEIPTYGAAFFTGQIFTKASPSNHKVIPVYVGVNIKGLHLLNMETKALLISLKYGCFMWQLGDTDTCFQIHSMENKMSFIVHTKQA -------------------------------------------------------------- |
Top |
Fusion Protein Functional Features |
![]() Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr7:91755566/chr7:91864960) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
![]() |
![]() |
Hgene | Tgene |
CYP51A1 | KRIT1 |
FUNCTION: A cytochrome P450 monooxygenase involved in sterol biosynthesis. Catalyzes 14-alpha demethylation of lanosterol and 24,25-dihydrolanosterol likely through sequential oxidative conversion of 14-alpha methyl group to hydroxymethyl, then to carboxylaldehyde, followed by the formation of the delta 14,15 double bond in the sterol core and concomitant release of formic acid (PubMed:20149798, PubMed:8619637). Mechanistically, uses molecular oxygen inserting one oxygen atom into a substrate, and reducing the second into a water molecule, with two electrons provided by NADPH via cytochrome P450 reductase (CPR; NADPH-ferrihemoprotein reductase) (PubMed:20149798, PubMed:8619637). {ECO:0000269|PubMed:20149798, ECO:0000269|PubMed:8619637}. | FUNCTION: Component of the CCM signaling pathway which is a crucial regulator of heart and vessel formation and integrity (By similarity). Negative regulator of angiogenesis. Inhibits endothelial proliferation, apoptosis, migration, lumen formation and sprouting angiogenesis in primary endothelial cells. Promotes AKT phosphorylation in a NOTCH-dependent and independent manner, and inhibits ERK1/2 phosphorylation indirectly through activation of the DELTA-NOTCH cascade. Acts in concert with CDH5 to establish and maintain correct endothelial cell polarity and vascular lumen and these effects are mediated by recruitment and activation of the Par polarity complex and RAP1B. Required for the localization of phosphorylated PRKCZ, PARD3, TIAM1 and RAP1B to the cell junction, and cell junction stabilization. Plays a role in integrin signaling via its interaction with ITGB1BP1; this prevents the interaction between ITGB1 and ITGB1BP1. Microtubule-associated protein that binds to phosphatidylinositol 4,5-bisphosphate (PIP2)-containing membranes in a GTP-bound RAP1-dependent manner. Plays an important role in the maintenance of the intracellular reactive oxygen species (ROS) homeostasis to prevent oxidative cellular damage. Regulates the homeostasis of intracellular ROS through an antioxidant pathway involving FOXO1 and SOD2. Facilitates the down-regulation of cyclin-D1 (CCND1) levels required for cell transition from proliferative growth to quiescence by preventing the accumulation of intracellular ROS through the modulation of FOXO1 and SOD2 levels. {ECO:0000250|UniProtKB:Q6S5J6, ECO:0000269|PubMed:11741838, ECO:0000269|PubMed:17916086, ECO:0000269|PubMed:20332120, ECO:0000269|PubMed:20616044, ECO:0000269|PubMed:20668652, ECO:0000269|PubMed:21633110, ECO:0000269|PubMed:23317506}. |
![]() |
- Retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Hgene | CYP51A1 | chr7:91755566 | chr7:91864960 | ENST00000003100 | - | 5 | 10 | 24_44 | 256.6666666666667 | 510.0 | Transmembrane | Helical |
Hgene | CYP51A1 | chr7:91755566 | chr7:91864960 | ENST00000450723 | - | 5 | 10 | 24_44 | 151.66666666666666 | 405.0 | Transmembrane | Helical |
Tgene | KRIT1 | chr7:91755566 | chr7:91864960 | ENST00000340022 | 6 | 19 | 420_734 | 161.66666666666666 | 737.0 | Domain | FERM | |
Tgene | KRIT1 | chr7:91755566 | chr7:91864960 | ENST00000394503 | 5 | 17 | 420_734 | 161.66666666666666 | 689.0 | Domain | FERM | |
Tgene | KRIT1 | chr7:91755566 | chr7:91864960 | ENST00000394505 | 6 | 19 | 420_734 | 161.66666666666666 | 737.0 | Domain | FERM | |
Tgene | KRIT1 | chr7:91755566 | chr7:91864960 | ENST00000394507 | 7 | 20 | 420_734 | 161.66666666666666 | 737.0 | Domain | FERM | |
Tgene | KRIT1 | chr7:91755566 | chr7:91864960 | ENST00000412043 | 6 | 19 | 420_734 | 161.66666666666666 | 737.0 | Domain | FERM | |
Tgene | KRIT1 | chr7:91755566 | chr7:91864960 | ENST00000340022 | 6 | 19 | 287_316 | 161.66666666666666 | 737.0 | Repeat | ANK 1 | |
Tgene | KRIT1 | chr7:91755566 | chr7:91864960 | ENST00000340022 | 6 | 19 | 320_350 | 161.66666666666666 | 737.0 | Repeat | ANK 2 | |
Tgene | KRIT1 | chr7:91755566 | chr7:91864960 | ENST00000340022 | 6 | 19 | 354_383 | 161.66666666666666 | 737.0 | Repeat | ANK 3 | |
Tgene | KRIT1 | chr7:91755566 | chr7:91864960 | ENST00000340022 | 6 | 19 | 388_419 | 161.66666666666666 | 737.0 | Repeat | ANK 4 | |
Tgene | KRIT1 | chr7:91755566 | chr7:91864960 | ENST00000394503 | 5 | 17 | 287_316 | 161.66666666666666 | 689.0 | Repeat | ANK 1 | |
Tgene | KRIT1 | chr7:91755566 | chr7:91864960 | ENST00000394503 | 5 | 17 | 320_350 | 161.66666666666666 | 689.0 | Repeat | ANK 2 | |
Tgene | KRIT1 | chr7:91755566 | chr7:91864960 | ENST00000394503 | 5 | 17 | 354_383 | 161.66666666666666 | 689.0 | Repeat | ANK 3 | |
Tgene | KRIT1 | chr7:91755566 | chr7:91864960 | ENST00000394503 | 5 | 17 | 388_419 | 161.66666666666666 | 689.0 | Repeat | ANK 4 | |
Tgene | KRIT1 | chr7:91755566 | chr7:91864960 | ENST00000394505 | 6 | 19 | 287_316 | 161.66666666666666 | 737.0 | Repeat | ANK 1 | |
Tgene | KRIT1 | chr7:91755566 | chr7:91864960 | ENST00000394505 | 6 | 19 | 320_350 | 161.66666666666666 | 737.0 | Repeat | ANK 2 | |
Tgene | KRIT1 | chr7:91755566 | chr7:91864960 | ENST00000394505 | 6 | 19 | 354_383 | 161.66666666666666 | 737.0 | Repeat | ANK 3 | |
Tgene | KRIT1 | chr7:91755566 | chr7:91864960 | ENST00000394505 | 6 | 19 | 388_419 | 161.66666666666666 | 737.0 | Repeat | ANK 4 | |
Tgene | KRIT1 | chr7:91755566 | chr7:91864960 | ENST00000394507 | 7 | 20 | 287_316 | 161.66666666666666 | 737.0 | Repeat | ANK 1 | |
Tgene | KRIT1 | chr7:91755566 | chr7:91864960 | ENST00000394507 | 7 | 20 | 320_350 | 161.66666666666666 | 737.0 | Repeat | ANK 2 | |
Tgene | KRIT1 | chr7:91755566 | chr7:91864960 | ENST00000394507 | 7 | 20 | 354_383 | 161.66666666666666 | 737.0 | Repeat | ANK 3 | |
Tgene | KRIT1 | chr7:91755566 | chr7:91864960 | ENST00000394507 | 7 | 20 | 388_419 | 161.66666666666666 | 737.0 | Repeat | ANK 4 | |
Tgene | KRIT1 | chr7:91755566 | chr7:91864960 | ENST00000412043 | 6 | 19 | 287_316 | 161.66666666666666 | 737.0 | Repeat | ANK 1 | |
Tgene | KRIT1 | chr7:91755566 | chr7:91864960 | ENST00000412043 | 6 | 19 | 320_350 | 161.66666666666666 | 737.0 | Repeat | ANK 2 | |
Tgene | KRIT1 | chr7:91755566 | chr7:91864960 | ENST00000412043 | 6 | 19 | 354_383 | 161.66666666666666 | 737.0 | Repeat | ANK 3 | |
Tgene | KRIT1 | chr7:91755566 | chr7:91864960 | ENST00000412043 | 6 | 19 | 388_419 | 161.66666666666666 | 737.0 | Repeat | ANK 4 |
- Not-retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Tgene | KRIT1 | chr7:91755566 | chr7:91864960 | ENST00000340022 | 6 | 19 | 1_170 | 161.66666666666666 | 737.0 | Region | Note=N-terminal domain similar to Nudix hydrolase domain | |
Tgene | KRIT1 | chr7:91755566 | chr7:91864960 | ENST00000394503 | 5 | 17 | 1_170 | 161.66666666666666 | 689.0 | Region | Note=N-terminal domain similar to Nudix hydrolase domain | |
Tgene | KRIT1 | chr7:91755566 | chr7:91864960 | ENST00000394505 | 6 | 19 | 1_170 | 161.66666666666666 | 737.0 | Region | Note=N-terminal domain similar to Nudix hydrolase domain | |
Tgene | KRIT1 | chr7:91755566 | chr7:91864960 | ENST00000394507 | 7 | 20 | 1_170 | 161.66666666666666 | 737.0 | Region | Note=N-terminal domain similar to Nudix hydrolase domain | |
Tgene | KRIT1 | chr7:91755566 | chr7:91864960 | ENST00000412043 | 6 | 19 | 1_170 | 161.66666666666666 | 737.0 | Region | Note=N-terminal domain similar to Nudix hydrolase domain |
Top |
Fusion Protein-Protein Interaction |
![]() |
![]() |
Gene | PPI interactors |
![]() |
Gene | STRING network |
CYP51A1 | |
KRIT1 |
![]() |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
![]() |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
Related Drugs to CYP51A1-KRIT1 |
![]() (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Drug | Source | PMID |
Top |
Related Diseases to CYP51A1-KRIT1 |
![]() (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Disease | Source | PMID |
![]() (DisGeNet 4.0) |
Partner | Gene | Disease ID | Disease name | # pubmeds | Source |