UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
![]() |
|||||||
|
Fusion Protein:CYP7B1-SCAF4 |
Fusion Protein Summary |
![]() |
Fusion partner gene information | Fusion gene name: CYP7B1-SCAF4 | FusionPDB ID: 21116 | FusionGDB2.0 ID: 21116 | Hgene | Tgene | Gene symbol | CYP7B1 | SCAF4 | Gene ID | 9420 | 57466 |
Gene name | cytochrome P450 family 7 subfamily B member 1 | SR-related CTD associated factor 4 | |
Synonyms | CBAS3|CP7B|SPG5A | SFRS15|SRA4 | |
Cytomap | 8q12.3 | 21q22.11 | |
Type of gene | protein-coding | protein-coding | |
Description | cytochrome P450 7B124-hydroxycholesterol 7-alpha-hydroxylase25-hydroxycholesterol 7-alpha-hydroxylase25/26-hydroxycholesterol 7-alpha-hydroxylase3-hydroxysteroid 7-alpha hydroxylasecytochrome P450, subfamily VIIB (oxysterol 7 alpha-hydroxylase), poly | SR-related and CTD-associated factor 4CTD-binding SR-like protein rA4SR-like CTD-associated factor 4pre-mRNA splicing SR protein rA4splicing factor serine alanine 15splicing factor, arginine/serine-rich 15 | |
Modification date | 20200313 | 20200314 | |
UniProtAcc | O75881 | . | |
Ensembl transtripts involved in fusion gene | ENST ids | ENST00000310193, ENST00000523954, | ENST00000286835, ENST00000399804, ENST00000434667, |
Fusion gene scores for assessment (based on all fusion genes of FusionGDB 2.0) | * DoF score | 4 X 4 X 4=64 | 12 X 11 X 4=528 |
# samples | 5 | 12 | |
** MAII score | log2(5/64*10)=-0.356143810225275 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | log2(12/528*10)=-2.13750352374993 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | |
Context (manual curation of fusion genes in FusionPDB) | PubMed: CYP7B1 [Title/Abstract] AND SCAF4 [Title/Abstract] AND fusion [Title/Abstract] | ||
Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) | CYP7B1(65711022)-SCAF4(33044667), # samples:1 | ||
Anticipated loss of major functional domain due to fusion event. | CYP7B1-SCAF4 seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. CYP7B1-SCAF4 seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. CYP7B1-SCAF4 seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. CYP7B1-SCAF4 seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. CYP7B1-SCAF4 seems lost the major protein functional domain in Hgene partner, which is a essential gene due to the frame-shifted ORF. CYP7B1-SCAF4 seems lost the major protein functional domain in Hgene partner, which is a IUPHAR drug target due to the frame-shifted ORF. CYP7B1-SCAF4 seems lost the major protein functional domain in Tgene partner, which is a essential gene due to the frame-shifted ORF. |
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
![]() |
Partner | Gene | GO ID | GO term | PubMed ID |
Tgene | SCAF4 | GO:2000805 | negative regulation of termination of RNA polymerase II transcription, poly(A)-coupled | 31104839 |
![]() * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
![]() |
![]() * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
![]() |
Top |
Fusion Gene Sample Information |
![]() |
![]() * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
ChimerDB4 | STAD | TCGA-IN-A7NU | CYP7B1 | chr8 | 65711022 | - | SCAF4 | chr21 | 33044667 | - |
Top |
Fusion ORF Analysis |
![]() |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
ENST00000310193 | CYP7B1 | chr8 | 65711022 | - | ENST00000434667 | SCAF4 | chr21 | 33044667 | - | 1423 | 296 | 31 | 1251 | 406 |
![]() |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
ENST00000310193 | ENST00000434667 | CYP7B1 | chr8 | 65711022 | - | SCAF4 | chr21 | 33044667 | - | 0.021770893 | 0.9782291 |
Top |
Fusion Amino Acid Sequences |
![]() |
>FusionGDB ID_FusionGDB isoform ID_FGname_Hgene_Hchr_Hbp_Henst_Tgene_Tchr_Tbp_Tenst_length(fusion AA) seq_BP >21116_21116_1_CYP7B1-SCAF4_CYP7B1_chr8_65711022_ENST00000310193_SCAF4_chr21_33044667_ENST00000434667_length(amino acids)=406AA_BP=88 MSALRAGQPLRPWTRGRRREKPPQAAESPTALFAGRPRAAHRGLARAGWQEKCPRPRAAFRWSGWASRAWPSPRPCCSWPSACLSGAPGT QGVAPGPVIGLQAPSTGLLGARPGLIPLQRPPGMPPPHLQRFPLMPPRPMPPHMMHRGPPPGPGGFAMPPPHGMKGPFPPHGPFVRPGGM PGLGGPGPGPGGPEDRDGRQQPPQQPQQQPQPQAPQQPQQQQQQQPPPSQQPPPTQQQPQQFRNDNRQQFNSGRDQERFGRRSFGNRVEN DRERYGNRNDDRDNSNRDRREWGRRSPDRDRHRDLEERNRRSSGHRDRERDSRDRESRREKEEARGKEKPEVTDRAGGNKTVEPPISQVG -------------------------------------------------------------- |
Top |
Fusion Protein Functional Features |
![]() Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr8:65711022/chr21:33044667) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
![]() |
![]() |
Hgene | Tgene |
CYP7B1 | . |
FUNCTION: A cytochrome P450 monooxygenase involved in the metabolism of endogenous oxysterols and steroid hormones, including neurosteroids (PubMed:10588945, PubMed:24491228). Mechanistically, uses molecular oxygen inserting one oxygen atom into a substrate, and reducing the second into a water molecule, with two electrons provided by NADPH via cytochrome P450 reductase (CPR; NADPH-ferrihemoprotein reductase) (PubMed:10588945, PubMed:24491228). Catalyzes the hydroxylation of carbon hydrogen bonds of steroids with a preference for 7-alpha position (PubMed:10588945, PubMed:24491228). Usually metabolizes steroids carrying a hydroxy group at position 3, functioning as a 3-hydroxy steroid 7-alpha hydroxylase (PubMed:24491228). Hydroxylates oxysterols, including 25-hydroxycholesterol and (25R)-cholest-5-ene-3beta,26-diol toward 7-alpha hydroxy derivatives, which may be transported to the liver and converted to bile acids (PubMed:9802883, PubMed:10588945). Via its product 7-alpha,25-dihydroxycholesterol, a ligand for the chemotactic G protein-coupled receptor GPR183/EBI2, regulates B cell migration in germinal centers of lymphoid organs, thus guiding efficient maturation of plasma B cells and overall antigen-specific humoral immune response (By similarity). 7-alpha hydroxylates neurosteroids, including 3beta-hydroxyandrost-5-en-17-one (dehydroepiandrosterone) and pregnenolone, both involved in hippocampus-associated memory and learning (PubMed:24491228). Metabolizes androstanoids toward 6- or 7-alpha hydroxy derivatives (PubMed:24491228). {ECO:0000250|UniProtKB:Q60991, ECO:0000269|PubMed:10588945, ECO:0000269|PubMed:24491228, ECO:0000269|PubMed:9802883}. | FUNCTION: Might normally function as a transcriptional repressor. EWS-fusion-proteins (EFPS) may play a role in the tumorigenic process. They may disturb gene expression by mimicking, or interfering with the normal function of CTD-POLII within the transcription initiation complex. They may also contribute to an aberrant activation of the fusion protein target genes. |
![]() |
- Retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Hgene | CYP7B1 | chr8:65711022 | chr21:33044667 | ENST00000310193 | - | 1 | 6 | 17_37 | 40.666666666666664 | 507.0 | Transmembrane | Helical |
Tgene | SCAF4 | chr8:65711022 | chr21:33044667 | ENST00000286835 | 18 | 20 | 957_966 | 829.3333333333334 | 1148.0 | Compositional bias | Note=Poly-Gln | |
Tgene | SCAF4 | chr8:65711022 | chr21:33044667 | ENST00000399804 | 18 | 20 | 957_966 | 807.3333333333334 | 1126.0 | Compositional bias | Note=Poly-Gln | |
Tgene | SCAF4 | chr8:65711022 | chr21:33044667 | ENST00000434667 | 17 | 19 | 957_966 | 814.3333333333334 | 1133.0 | Compositional bias | Note=Poly-Gln |
- Not-retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Hgene | CYP7B1 | chr8:65711022 | chr21:33044667 | ENST00000310193 | - | 1 | 6 | 289_309 | 40.666666666666664 | 507.0 | Transmembrane | Helical |
Tgene | SCAF4 | chr8:65711022 | chr21:33044667 | ENST00000286835 | 18 | 20 | 155_158 | 829.3333333333334 | 1148.0 | Compositional bias | Note=Poly-Pro | |
Tgene | SCAF4 | chr8:65711022 | chr21:33044667 | ENST00000286835 | 18 | 20 | 304_311 | 829.3333333333334 | 1148.0 | Compositional bias | Note=Poly-Ala | |
Tgene | SCAF4 | chr8:65711022 | chr21:33044667 | ENST00000286835 | 18 | 20 | 313_316 | 829.3333333333334 | 1148.0 | Compositional bias | Note=Poly-Pro | |
Tgene | SCAF4 | chr8:65711022 | chr21:33044667 | ENST00000286835 | 18 | 20 | 716_723 | 829.3333333333334 | 1148.0 | Compositional bias | Note=Poly-Pro | |
Tgene | SCAF4 | chr8:65711022 | chr21:33044667 | ENST00000286835 | 18 | 20 | 740_746 | 829.3333333333334 | 1148.0 | Compositional bias | Note=Poly-Pro | |
Tgene | SCAF4 | chr8:65711022 | chr21:33044667 | ENST00000399804 | 18 | 20 | 155_158 | 807.3333333333334 | 1126.0 | Compositional bias | Note=Poly-Pro | |
Tgene | SCAF4 | chr8:65711022 | chr21:33044667 | ENST00000399804 | 18 | 20 | 304_311 | 807.3333333333334 | 1126.0 | Compositional bias | Note=Poly-Ala | |
Tgene | SCAF4 | chr8:65711022 | chr21:33044667 | ENST00000399804 | 18 | 20 | 313_316 | 807.3333333333334 | 1126.0 | Compositional bias | Note=Poly-Pro | |
Tgene | SCAF4 | chr8:65711022 | chr21:33044667 | ENST00000399804 | 18 | 20 | 716_723 | 807.3333333333334 | 1126.0 | Compositional bias | Note=Poly-Pro | |
Tgene | SCAF4 | chr8:65711022 | chr21:33044667 | ENST00000399804 | 18 | 20 | 740_746 | 807.3333333333334 | 1126.0 | Compositional bias | Note=Poly-Pro | |
Tgene | SCAF4 | chr8:65711022 | chr21:33044667 | ENST00000434667 | 17 | 19 | 155_158 | 814.3333333333334 | 1133.0 | Compositional bias | Note=Poly-Pro | |
Tgene | SCAF4 | chr8:65711022 | chr21:33044667 | ENST00000434667 | 17 | 19 | 304_311 | 814.3333333333334 | 1133.0 | Compositional bias | Note=Poly-Ala | |
Tgene | SCAF4 | chr8:65711022 | chr21:33044667 | ENST00000434667 | 17 | 19 | 313_316 | 814.3333333333334 | 1133.0 | Compositional bias | Note=Poly-Pro | |
Tgene | SCAF4 | chr8:65711022 | chr21:33044667 | ENST00000434667 | 17 | 19 | 716_723 | 814.3333333333334 | 1133.0 | Compositional bias | Note=Poly-Pro | |
Tgene | SCAF4 | chr8:65711022 | chr21:33044667 | ENST00000434667 | 17 | 19 | 740_746 | 814.3333333333334 | 1133.0 | Compositional bias | Note=Poly-Pro | |
Tgene | SCAF4 | chr8:65711022 | chr21:33044667 | ENST00000286835 | 18 | 20 | 1_139 | 829.3333333333334 | 1148.0 | Domain | CID | |
Tgene | SCAF4 | chr8:65711022 | chr21:33044667 | ENST00000286835 | 18 | 20 | 508_582 | 829.3333333333334 | 1148.0 | Domain | RRM | |
Tgene | SCAF4 | chr8:65711022 | chr21:33044667 | ENST00000399804 | 18 | 20 | 1_139 | 807.3333333333334 | 1126.0 | Domain | CID | |
Tgene | SCAF4 | chr8:65711022 | chr21:33044667 | ENST00000399804 | 18 | 20 | 508_582 | 807.3333333333334 | 1126.0 | Domain | RRM | |
Tgene | SCAF4 | chr8:65711022 | chr21:33044667 | ENST00000434667 | 17 | 19 | 1_139 | 814.3333333333334 | 1133.0 | Domain | CID | |
Tgene | SCAF4 | chr8:65711022 | chr21:33044667 | ENST00000434667 | 17 | 19 | 508_582 | 814.3333333333334 | 1133.0 | Domain | RRM |
Top |
Fusion Protein-Protein Interaction |
![]() |
![]() |
Gene | PPI interactors |
![]() |
Gene | STRING network |
CYP7B1 | |
SCAF4 |
![]() |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
![]() |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
Related Drugs to CYP7B1-SCAF4 |
![]() (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Drug | Source | PMID |
Top |
Related Diseases to CYP7B1-SCAF4 |
![]() (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Disease | Source | PMID |
![]() (DisGeNet 4.0) |
Partner | Gene | Disease ID | Disease name | # pubmeds | Source |