UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
![]() |
|||||||
|
Fusion Protein:DCAF6-ILDR2 |
Fusion Protein Summary |
![]() |
Fusion partner gene information | Fusion gene name: DCAF6-ILDR2 | FusionPDB ID: 21521 | FusionGDB2.0 ID: 21521 | Hgene | Tgene | Gene symbol | DCAF6 | ILDR2 | Gene ID | 55827 | 387597 |
Gene name | DDB1 and CUL4 associated factor 6 | immunoglobulin like domain containing receptor 2 | |
Synonyms | 1200006M05Rik|ARCAP|IQWD1|MSTP055|NRIP|PC326 | C1orf32|dJ782G3.1 | |
Cytomap | 1q24.2 | 1q24.1 | |
Type of gene | protein-coding | protein-coding | |
Description | DDB1- and CUL4-associated factor 6IQ motif and WD repeat-containing protein 1IQ motif and WD repeats 1androgen receptor complex-associated proteinnuclear receptor interaction protein | immunoglobulin-like domain-containing receptor 2 | |
Modification date | 20200313 | 20200313 | |
UniProtAcc | Q58WW2 | Q71H61 | |
Ensembl transtripts involved in fusion gene | ENST ids | ENST00000312263, ENST00000367840, ENST00000367843, ENST00000432587, ENST00000470919, | ENST00000469934, ENST00000525740, ENST00000526687, ENST00000528703, ENST00000529071, ENST00000529387, ENST00000271417, |
Fusion gene scores for assessment (based on all fusion genes of FusionGDB 2.0) | * DoF score | 13 X 10 X 8=1040 | 6 X 6 X 4=144 |
# samples | 17 | 6 | |
** MAII score | log2(17/1040*10)=-2.61297687689075 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | log2(6/144*10)=-1.26303440583379 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | |
Context (manual curation of fusion genes in FusionPDB) | PubMed: DCAF6 [Title/Abstract] AND ILDR2 [Title/Abstract] AND fusion [Title/Abstract] | ||
Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) | DCAF6(167906246)-ILDR2(166908807), # samples:2 | ||
Anticipated loss of major functional domain due to fusion event. | DCAF6-ILDR2 seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. DCAF6-ILDR2 seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. DCAF6-ILDR2 seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. DCAF6-ILDR2 seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. |
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
![]() |
Partner | Gene | GO ID | GO term | PubMed ID |
![]() * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
![]() |
![]() * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
![]() |
Top |
Fusion Gene Sample Information |
![]() |
![]() * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
ChimerDB4 | LUAD | TCGA-55-7576-01A | DCAF6 | chr1 | 167906246 | + | ILDR2 | chr1 | 166908807 | - |
Top |
Fusion ORF Analysis |
![]() |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
ENST00000367843 | DCAF6 | chr1 | 167906246 | + | ENST00000271417 | ILDR2 | chr1 | 166908807 | - | 7918 | 348 | 251 | 1768 | 505 |
ENST00000432587 | DCAF6 | chr1 | 167906246 | + | ENST00000271417 | ILDR2 | chr1 | 166908807 | - | 7880 | 310 | 213 | 1730 | 505 |
ENST00000312263 | DCAF6 | chr1 | 167906246 | + | ENST00000271417 | ILDR2 | chr1 | 166908807 | - | 7871 | 301 | 204 | 1721 | 505 |
ENST00000367840 | DCAF6 | chr1 | 167906246 | + | ENST00000271417 | ILDR2 | chr1 | 166908807 | - | 7761 | 191 | 94 | 1611 | 505 |
![]() |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
ENST00000367843 | ENST00000271417 | DCAF6 | chr1 | 167906246 | + | ILDR2 | chr1 | 166908807 | - | 0.003314599 | 0.99668545 |
ENST00000432587 | ENST00000271417 | DCAF6 | chr1 | 167906246 | + | ILDR2 | chr1 | 166908807 | - | 0.00338288 | 0.99661714 |
ENST00000312263 | ENST00000271417 | DCAF6 | chr1 | 167906246 | + | ILDR2 | chr1 | 166908807 | - | 0.003395807 | 0.9966042 |
ENST00000367840 | ENST00000271417 | DCAF6 | chr1 | 167906246 | + | ILDR2 | chr1 | 166908807 | - | 0.003212367 | 0.99678767 |
Top |
Fusion Amino Acid Sequences |
![]() |
>FusionGDB ID_FusionGDB isoform ID_FGname_Hgene_Hchr_Hbp_Henst_Tgene_Tchr_Tbp_Tenst_length(fusion AA) seq_BP >21521_21521_1_DCAF6-ILDR2_DCAF6_chr1_167906246_ENST00000312263_ILDR2_chr1_166908807_ENST00000271417_length(amino acids)=505AA_BP=31 MSRGGSYPHLLWDVRKRSLGLEDPSRLRSRYLGRTGLLADLLPSFAVEIMPEWVFVGLVLLGVFLFFVLVGICWCQCCPHSCCCYVRCPC CPDSCCCPQALYEAGKAAKAGYPPSVSGVPGPYSIPSVPLGGAPSSGMLMDKPHPPPLAPSDSTGGSHSVRKGYRIQADKERDSMKVLYY VEKELAQFDPARRMRGRYNNTISELSSLHEEDSNFRQSFHQMRSKQFPVSGDLESNPDYWSGVMGGSSGASRGPSAMEYNKEDRESFRHS QPRSKSEMLSRKNFATGVPAVSMDELAAFADSYGQRPRRADGNSHEARGGSRFERSESRAHSGFYQDDSLEEYYGQRSRSREPLTDADRG WAFSPARRRPAEDAHLPRLVSRTPGTAPKYDHSYLGSARERQARPEGASRGGSLETPSKRSAQLGPRSASYYAWSPPGTYKAGSSQDDQE -------------------------------------------------------------- >21521_21521_2_DCAF6-ILDR2_DCAF6_chr1_167906246_ENST00000367840_ILDR2_chr1_166908807_ENST00000271417_length(amino acids)=505AA_BP=31 MSRGGSYPHLLWDVRKRSLGLEDPSRLRSRYLGRTGLLADLLPSFAVEIMPEWVFVGLVLLGVFLFFVLVGICWCQCCPHSCCCYVRCPC CPDSCCCPQALYEAGKAAKAGYPPSVSGVPGPYSIPSVPLGGAPSSGMLMDKPHPPPLAPSDSTGGSHSVRKGYRIQADKERDSMKVLYY VEKELAQFDPARRMRGRYNNTISELSSLHEEDSNFRQSFHQMRSKQFPVSGDLESNPDYWSGVMGGSSGASRGPSAMEYNKEDRESFRHS QPRSKSEMLSRKNFATGVPAVSMDELAAFADSYGQRPRRADGNSHEARGGSRFERSESRAHSGFYQDDSLEEYYGQRSRSREPLTDADRG WAFSPARRRPAEDAHLPRLVSRTPGTAPKYDHSYLGSARERQARPEGASRGGSLETPSKRSAQLGPRSASYYAWSPPGTYKAGSSQDDQE -------------------------------------------------------------- >21521_21521_3_DCAF6-ILDR2_DCAF6_chr1_167906246_ENST00000367843_ILDR2_chr1_166908807_ENST00000271417_length(amino acids)=505AA_BP=31 MSRGGSYPHLLWDVRKRSLGLEDPSRLRSRYLGRTGLLADLLPSFAVEIMPEWVFVGLVLLGVFLFFVLVGICWCQCCPHSCCCYVRCPC CPDSCCCPQALYEAGKAAKAGYPPSVSGVPGPYSIPSVPLGGAPSSGMLMDKPHPPPLAPSDSTGGSHSVRKGYRIQADKERDSMKVLYY VEKELAQFDPARRMRGRYNNTISELSSLHEEDSNFRQSFHQMRSKQFPVSGDLESNPDYWSGVMGGSSGASRGPSAMEYNKEDRESFRHS QPRSKSEMLSRKNFATGVPAVSMDELAAFADSYGQRPRRADGNSHEARGGSRFERSESRAHSGFYQDDSLEEYYGQRSRSREPLTDADRG WAFSPARRRPAEDAHLPRLVSRTPGTAPKYDHSYLGSARERQARPEGASRGGSLETPSKRSAQLGPRSASYYAWSPPGTYKAGSSQDDQE -------------------------------------------------------------- >21521_21521_4_DCAF6-ILDR2_DCAF6_chr1_167906246_ENST00000432587_ILDR2_chr1_166908807_ENST00000271417_length(amino acids)=505AA_BP=31 MSRGGSYPHLLWDVRKRSLGLEDPSRLRSRYLGRTGLLADLLPSFAVEIMPEWVFVGLVLLGVFLFFVLVGICWCQCCPHSCCCYVRCPC CPDSCCCPQALYEAGKAAKAGYPPSVSGVPGPYSIPSVPLGGAPSSGMLMDKPHPPPLAPSDSTGGSHSVRKGYRIQADKERDSMKVLYY VEKELAQFDPARRMRGRYNNTISELSSLHEEDSNFRQSFHQMRSKQFPVSGDLESNPDYWSGVMGGSSGASRGPSAMEYNKEDRESFRHS QPRSKSEMLSRKNFATGVPAVSMDELAAFADSYGQRPRRADGNSHEARGGSRFERSESRAHSGFYQDDSLEEYYGQRSRSREPLTDADRG WAFSPARRRPAEDAHLPRLVSRTPGTAPKYDHSYLGSARERQARPEGASRGGSLETPSKRSAQLGPRSASYYAWSPPGTYKAGSSQDDQE -------------------------------------------------------------- |
Top |
Fusion Protein Functional Features |
![]() Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr1:167906246/chr1:166908807) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
![]() |
![]() |
Hgene | Tgene |
DCAF6 | ILDR2 |
FUNCTION: Ligand-dependent coactivator of nuclear receptors. Enhance transcriptional activity of the nuclear receptors NR3C1 and AR. May function as a substrate receptor for CUL4-DDB1 E3 ubiquitin-protein ligase complex. {ECO:0000269|PubMed:15784617, ECO:0000269|PubMed:16949367, ECO:0000269|PubMed:16964240}. | FUNCTION: May be involved in lipid homeostasis and ER stress pathways. {ECO:0000250}. |
![]() |
- Retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Tgene | ILDR2 | chr1:167906246 | chr1:166908807 | ENST00000271417 | 2 | 10 | 207_231 | 166.33333333333334 | 640.0 | Compositional bias | Note=Cys-rich | |
Tgene | ILDR2 | chr1:167906246 | chr1:166908807 | ENST00000271417 | 2 | 10 | 208_639 | 166.33333333333334 | 640.0 | Topological domain | Cytoplasmic | |
Tgene | ILDR2 | chr1:167906246 | chr1:166908807 | ENST00000271417 | 2 | 10 | 187_207 | 166.33333333333334 | 640.0 | Transmembrane | Helical |
- Not-retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Hgene | DCAF6 | chr1:167906246 | chr1:166908807 | ENST00000312263 | + | 1 | 19 | 676_705 | 32.333333333333336 | 861.0 | Domain | IQ |
Hgene | DCAF6 | chr1:167906246 | chr1:166908807 | ENST00000367840 | + | 1 | 22 | 676_705 | 32.333333333333336 | 952.0 | Domain | IQ |
Hgene | DCAF6 | chr1:167906246 | chr1:166908807 | ENST00000367843 | + | 1 | 20 | 676_705 | 32.333333333333336 | 881.0 | Domain | IQ |
Hgene | DCAF6 | chr1:167906246 | chr1:166908807 | ENST00000432587 | + | 1 | 21 | 676_705 | 32.333333333333336 | 921.0 | Domain | IQ |
Hgene | DCAF6 | chr1:167906246 | chr1:166908807 | ENST00000312263 | + | 1 | 19 | 139_179 | 32.333333333333336 | 861.0 | Repeat | Note=WD 3 |
Hgene | DCAF6 | chr1:167906246 | chr1:166908807 | ENST00000312263 | + | 1 | 19 | 189_229 | 32.333333333333336 | 861.0 | Repeat | Note=WD 4 |
Hgene | DCAF6 | chr1:167906246 | chr1:166908807 | ENST00000312263 | + | 1 | 19 | 251_290 | 32.333333333333336 | 861.0 | Repeat | Note=WD 5 |
Hgene | DCAF6 | chr1:167906246 | chr1:166908807 | ENST00000312263 | + | 1 | 19 | 49_88 | 32.333333333333336 | 861.0 | Repeat | Note=WD 1 |
Hgene | DCAF6 | chr1:167906246 | chr1:166908807 | ENST00000312263 | + | 1 | 19 | 718_756 | 32.333333333333336 | 861.0 | Repeat | Note=WD 6 |
Hgene | DCAF6 | chr1:167906246 | chr1:166908807 | ENST00000312263 | + | 1 | 19 | 759_798 | 32.333333333333336 | 861.0 | Repeat | Note=WD 7 |
Hgene | DCAF6 | chr1:167906246 | chr1:166908807 | ENST00000312263 | + | 1 | 19 | 92_133 | 32.333333333333336 | 861.0 | Repeat | Note=WD 2 |
Hgene | DCAF6 | chr1:167906246 | chr1:166908807 | ENST00000367840 | + | 1 | 22 | 139_179 | 32.333333333333336 | 952.0 | Repeat | Note=WD 3 |
Hgene | DCAF6 | chr1:167906246 | chr1:166908807 | ENST00000367840 | + | 1 | 22 | 189_229 | 32.333333333333336 | 952.0 | Repeat | Note=WD 4 |
Hgene | DCAF6 | chr1:167906246 | chr1:166908807 | ENST00000367840 | + | 1 | 22 | 251_290 | 32.333333333333336 | 952.0 | Repeat | Note=WD 5 |
Hgene | DCAF6 | chr1:167906246 | chr1:166908807 | ENST00000367840 | + | 1 | 22 | 49_88 | 32.333333333333336 | 952.0 | Repeat | Note=WD 1 |
Hgene | DCAF6 | chr1:167906246 | chr1:166908807 | ENST00000367840 | + | 1 | 22 | 718_756 | 32.333333333333336 | 952.0 | Repeat | Note=WD 6 |
Hgene | DCAF6 | chr1:167906246 | chr1:166908807 | ENST00000367840 | + | 1 | 22 | 759_798 | 32.333333333333336 | 952.0 | Repeat | Note=WD 7 |
Hgene | DCAF6 | chr1:167906246 | chr1:166908807 | ENST00000367840 | + | 1 | 22 | 92_133 | 32.333333333333336 | 952.0 | Repeat | Note=WD 2 |
Hgene | DCAF6 | chr1:167906246 | chr1:166908807 | ENST00000367843 | + | 1 | 20 | 139_179 | 32.333333333333336 | 881.0 | Repeat | Note=WD 3 |
Hgene | DCAF6 | chr1:167906246 | chr1:166908807 | ENST00000367843 | + | 1 | 20 | 189_229 | 32.333333333333336 | 881.0 | Repeat | Note=WD 4 |
Hgene | DCAF6 | chr1:167906246 | chr1:166908807 | ENST00000367843 | + | 1 | 20 | 251_290 | 32.333333333333336 | 881.0 | Repeat | Note=WD 5 |
Hgene | DCAF6 | chr1:167906246 | chr1:166908807 | ENST00000367843 | + | 1 | 20 | 49_88 | 32.333333333333336 | 881.0 | Repeat | Note=WD 1 |
Hgene | DCAF6 | chr1:167906246 | chr1:166908807 | ENST00000367843 | + | 1 | 20 | 718_756 | 32.333333333333336 | 881.0 | Repeat | Note=WD 6 |
Hgene | DCAF6 | chr1:167906246 | chr1:166908807 | ENST00000367843 | + | 1 | 20 | 759_798 | 32.333333333333336 | 881.0 | Repeat | Note=WD 7 |
Hgene | DCAF6 | chr1:167906246 | chr1:166908807 | ENST00000367843 | + | 1 | 20 | 92_133 | 32.333333333333336 | 881.0 | Repeat | Note=WD 2 |
Hgene | DCAF6 | chr1:167906246 | chr1:166908807 | ENST00000432587 | + | 1 | 21 | 139_179 | 32.333333333333336 | 921.0 | Repeat | Note=WD 3 |
Hgene | DCAF6 | chr1:167906246 | chr1:166908807 | ENST00000432587 | + | 1 | 21 | 189_229 | 32.333333333333336 | 921.0 | Repeat | Note=WD 4 |
Hgene | DCAF6 | chr1:167906246 | chr1:166908807 | ENST00000432587 | + | 1 | 21 | 251_290 | 32.333333333333336 | 921.0 | Repeat | Note=WD 5 |
Hgene | DCAF6 | chr1:167906246 | chr1:166908807 | ENST00000432587 | + | 1 | 21 | 49_88 | 32.333333333333336 | 921.0 | Repeat | Note=WD 1 |
Hgene | DCAF6 | chr1:167906246 | chr1:166908807 | ENST00000432587 | + | 1 | 21 | 718_756 | 32.333333333333336 | 921.0 | Repeat | Note=WD 6 |
Hgene | DCAF6 | chr1:167906246 | chr1:166908807 | ENST00000432587 | + | 1 | 21 | 759_798 | 32.333333333333336 | 921.0 | Repeat | Note=WD 7 |
Hgene | DCAF6 | chr1:167906246 | chr1:166908807 | ENST00000432587 | + | 1 | 21 | 92_133 | 32.333333333333336 | 921.0 | Repeat | Note=WD 2 |
Tgene | ILDR2 | chr1:167906246 | chr1:166908807 | ENST00000271417 | 2 | 10 | 21_162 | 166.33333333333334 | 640.0 | Domain | Note=Ig-like V-type | |
Tgene | ILDR2 | chr1:167906246 | chr1:166908807 | ENST00000271417 | 2 | 10 | 21_186 | 166.33333333333334 | 640.0 | Topological domain | Lumenal |
Top |
Fusion Protein-Protein Interaction |
![]() |
![]() |
Gene | PPI interactors |
![]() |
Gene | STRING network |
DCAF6 | |
ILDR2 |
![]() |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
![]() |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
Related Drugs to DCAF6-ILDR2 |
![]() (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Drug | Source | PMID |
Top |
Related Diseases to DCAF6-ILDR2 |
![]() (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Disease | Source | PMID |
![]() (DisGeNet 4.0) |
Partner | Gene | Disease ID | Disease name | # pubmeds | Source |