| UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
|
|||||||
|
Fusion Protein:DCPS-CCND1 |
Fusion Protein Summary |
 Fusion gene summary |
| Fusion partner gene information | Fusion gene name: DCPS-CCND1 | FusionPDB ID: 21655 | FusionGDB2.0 ID: 21655 | Hgene | Tgene | Gene symbol | DCPS | CCND1 | Gene ID | 28960 | 595 |
| Gene name | decapping enzyme, scavenger | cyclin D1 | |
| Synonyms | ARS|DCS1|HINT-5|HINT5|HSL1|HSPC015 | BCL1|D11S287E|PRAD1|U21B31 | |
| Cytomap | 11q24.2 | 11q13.3 | |
| Type of gene | protein-coding | protein-coding | |
| Description | m7GpppX diphosphatase5'-(N(7)-methyl 5'-triphosphoguanosine)-[mRNA] diphosphatasedecapping scavenger enzymeepididymis secretory sperm binding proteinheat shock-like protein 1hint-related 7meGMP-directed hydrolasehistidine triad nucleotide-binding pr | G1/S-specific cyclin-D1B-cell CLL/lymphoma 1B-cell lymphoma 1 proteinBCL-1 oncogenePRAD1 oncogene | |
| Modification date | 20200313 | 20200327 | |
| UniProtAcc | Q96C86 | P24385 | |
| Ensembl transtripts involved in fusion gene | ENST ids | ENST00000263579, ENST00000530860, | ENST00000536559, ENST00000227507, |
| Fusion gene scores for assessment (based on all fusion genes of FusionGDB 2.0) | * DoF score | 5 X 3 X 3=45 | 15 X 16 X 5=1200 |
| # samples | 5 | 16 | |
| ** MAII score | log2(5/45*10)=0.15200309344505 effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs). DoF>8 and MAII>0 | log2(16/1200*10)=-2.90689059560852 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | |
| Context (manual curation of fusion genes in FusionPDB) | PubMed: DCPS [Title/Abstract] AND CCND1 [Title/Abstract] AND fusion [Title/Abstract] | ||
| Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) | DCPS(126176639)-CCND1(69462761), # samples:2 | ||
| Anticipated loss of major functional domain due to fusion event. | DCPS-CCND1 seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. DCPS-CCND1 seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. DCPS-CCND1 seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. DCPS-CCND1 seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. DCPS-CCND1 seems lost the major protein functional domain in Hgene partner, which is a cell metabolism gene due to the frame-shifted ORF. DCPS-CCND1 seems lost the major protein functional domain in Hgene partner, which is a essential gene due to the frame-shifted ORF. DCPS-CCND1 seems lost the major protein functional domain in Tgene partner, which is a CGC due to the frame-shifted ORF. DCPS-CCND1 seems lost the major protein functional domain in Tgene partner, which is a essential gene due to the frame-shifted ORF. | ||
| * DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
| Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Partner | Gene | GO ID | GO term | PubMed ID |
| Hgene | DCPS | GO:0036245 | cellular response to menadione | 16140270 |
| Hgene | DCPS | GO:0043069 | negative regulation of programmed cell death | 16140270 |
| Hgene | DCPS | GO:0045292 | mRNA cis splicing, via spliceosome | 18426921 |
| Tgene | CCND1 | GO:0000082 | G1/S transition of mitotic cell cycle | 19412162 |
| Tgene | CCND1 | GO:0000122 | negative regulation of transcription by RNA polymerase II | 16569215|18417529 |
| Tgene | CCND1 | GO:0001934 | positive regulation of protein phosphorylation | 8114739 |
| Tgene | CCND1 | GO:0006974 | cellular response to DNA damage stimulus | 19412162 |
| Tgene | CCND1 | GO:0010971 | positive regulation of G2/M transition of mitotic cell cycle | 19124461 |
| Tgene | CCND1 | GO:0031571 | mitotic G1 DNA damage checkpoint | 19412162 |
| Tgene | CCND1 | GO:0044321 | response to leptin | 17344214 |
| Tgene | CCND1 | GO:0045737 | positive regulation of cyclin-dependent protein serine/threonine kinase activity | 8114739 |
| Tgene | CCND1 | GO:0070141 | response to UV-A | 18483258 |
| Tgene | CCND1 | GO:0071157 | negative regulation of cell cycle arrest | 19124461 |
| Fusion gene breakpoints across DCPS (5'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
 |
| Fusion gene breakpoints across CCND1 (3'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
 |
Top |
Fusion Gene Sample Information |
| Fusion gene information from FusionGDB2.0. |
| Fusion gene information from two resources (ChiTars 5.0 and ChimerDB 4.0) * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
| Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
| ChimerDB4 | ESCA | TCGA-IG-A3I8-01A | DCPS | chr11 | 126176639 | + | CCND1 | chr11 | 69462762 | + |
| ChimerDB4 | ESCA | TCGA-IG-A3I8 | DCPS | chr11 | 126176639 | + | CCND1 | chr11 | 69457798 | + |
| ChimerDB4 | ESCA | TCGA-IG-A3I8 | DCPS | chr11 | 126176639 | + | CCND1 | chr11 | 69462761 | + |
Top |
Fusion ORF Analysis |
| Fusion information from ORFfinder translation from full-length transcript sequence from FusionPDB. |
| Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
| ENST00000263579 | DCPS | chr11 | 126176639 | + | ENST00000227507 | CCND1 | chr11 | 69462762 | + | 4211 | 705 | 107 | 1018 | 303 |
| ENST00000263579 | DCPS | chr11 | 126176639 | + | ENST00000227507 | CCND1 | chr11 | 69462761 | + | 4211 | 705 | 107 | 1018 | 303 |
| DeepORF prediction of the coding potential based on the fusion transcript sequence of in-frame fusion genes. DeepORF is a coding potential classifier based on convolutional neural network by comparing the real Ribo-seq data. If the no-coding score < 0.5 and coding score > 0.5, then the in-frame fusion transcript is predicted as being likely translated. |
| Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
| ENST00000263579 | ENST00000227507 | DCPS | chr11 | 126176639 | + | CCND1 | chr11 | 69462762 | + | 0.000255026 | 0.99974495 |
| ENST00000263579 | ENST00000227507 | DCPS | chr11 | 126176639 | + | CCND1 | chr11 | 69462761 | + | 0.000255026 | 0.99974495 |
Top |
Fusion Amino Acid Sequences |
| For individual full-length fusion transcript sequence from FusionPDB, we ran ORFfinder and chose the longest ORF among the all predicted ones. |
| >FusionGDB ID_FusionGDB isoform ID_FGname_Hgene_Hchr_Hbp_Henst_Tgene_Tchr_Tbp_Tenst_length(fusion AA) seq_BP >21655_21655_1_DCPS-CCND1_DCPS_chr11_126176639_ENST00000263579_CCND1_chr11_69462761_ENST00000227507_length(amino acids)=303AA_BP=199 MRAGRHHNGAKGSNSVERRALGQVSGLRHARHASRRSGCQSRVGRELAAQPGRWTRARGGASAGGAGAHRLRGSMADAAPQLGKRKRELD VEEAHAASTEEKEAGVGNGTCAPVRLPFSGFRLQKVLRESARDKIIFLHGKVNEASGDGDGEDAVVILEKTPFQVEQVAQLLTGSPELQL QFSNDIYSTYHLFPPRQLNDVKFISNPPSMVAAGSVVAAVQGLNLRSPNNFLSYYRLTRFLSRVIKCDPDCLRACQEQIEALLESSLRQA -------------------------------------------------------------- >21655_21655_2_DCPS-CCND1_DCPS_chr11_126176639_ENST00000263579_CCND1_chr11_69462762_ENST00000227507_length(amino acids)=303AA_BP=199 MRAGRHHNGAKGSNSVERRALGQVSGLRHARHASRRSGCQSRVGRELAAQPGRWTRARGGASAGGAGAHRLRGSMADAAPQLGKRKRELD VEEAHAASTEEKEAGVGNGTCAPVRLPFSGFRLQKVLRESARDKIIFLHGKVNEASGDGDGEDAVVILEKTPFQVEQVAQLLTGSPELQL QFSNDIYSTYHLFPPRQLNDVKFISNPPSMVAAGSVVAAVQGLNLRSPNNFLSYYRLTRFLSRVIKCDPDCLRACQEQIEALLESSLRQA -------------------------------------------------------------- |
Top |
Fusion Protein Functional Features |
| Four levels of functional features of fusion genes Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr11:126176639/chr11:69462761) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
 |
| Main function of each fusion partner protein. (from UniProt) |
| Hgene | Tgene |
| DCPS | CCND1 |
| FUNCTION: Decapping scavenger enzyme that catalyzes the cleavage of a residual cap structure following the degradation of mRNAs by the 3'->5' exosome-mediated mRNA decay pathway. Hydrolyzes cap analog structures like 7-methylguanosine nucleoside triphosphate (m7GpppG) with up to 10 nucleotide substrates (small capped oligoribonucleotides) and specifically releases 5'-phosphorylated RNA fragments and 7-methylguanosine monophosphate (m7GMP). Cleaves cap analog structures like tri-methyl guanosine nucleoside triphosphate (m3(2,2,7)GpppG) with very poor efficiency. Does not hydrolyze unmethylated cap analog (GpppG) and shows no decapping activity on intact m7GpppG-capped mRNA molecules longer than 25 nucleotides. Does not hydrolyze 7-methylguanosine diphosphate (m7GDP) to m7GMP (PubMed:22985415). May also play a role in the 5'->3 mRNA decay pathway; m7GDP, the downstream product released by the 5'->3' mRNA mediated decapping activity, may be also converted by DCPS to m7GMP (PubMed:14523240). Binds to m7GpppG and strongly to m7GDP. Plays a role in first intron splicing of pre-mRNAs. Inhibits activation-induced cell death. {ECO:0000269|PubMed:11747811, ECO:0000269|PubMed:12198172, ECO:0000269|PubMed:12871939, ECO:0000269|PubMed:14523240, ECO:0000269|PubMed:15273322, ECO:0000269|PubMed:15383679, ECO:0000269|PubMed:15769464, ECO:0000269|PubMed:16140270, ECO:0000269|PubMed:18426921, ECO:0000269|PubMed:22985415}. | FUNCTION: Regulatory component of the cyclin D1-CDK4 (DC) complex that phosphorylates and inhibits members of the retinoblastoma (RB) protein family including RB1 and regulates the cell-cycle during G(1)/S transition. Phosphorylation of RB1 allows dissociation of the transcription factor E2F from the RB/E2F complex and the subsequent transcription of E2F target genes which are responsible for the progression through the G(1) phase. Hypophosphorylates RB1 in early G(1) phase. Cyclin D-CDK4 complexes are major integrators of various mitogenenic and antimitogenic signals. Also substrate for SMAD3, phosphorylating SMAD3 in a cell-cycle-dependent manner and repressing its transcriptional activity. Component of the ternary complex, cyclin D1/CDK4/CDKN1B, required for nuclear translocation and activity of the cyclin D-CDK4 complex. Exhibits transcriptional corepressor activity with INSM1 on the NEUROD1 and INS promoters in a cell cycle-independent manner. {ECO:0000269|PubMed:15241418, ECO:0000269|PubMed:16569215, ECO:0000269|PubMed:18417529, ECO:0000269|PubMed:9106657}. |
| Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
| - Retained protein feature among the 13 regional features. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
| Tgene | CCND1 | chr11:126176639 | chr11:69462761 | ENST00000227507 | 2 | 5 | 272_280 | 191.33333333333334 | 296.0 | Compositional bias | Note=Poly-Glu | |
| Tgene | CCND1 | chr11:126176639 | chr11:69462762 | ENST00000227507 | 2 | 5 | 272_280 | 191.33333333333334 | 296.0 | Compositional bias | Note=Poly-Glu |
| - Not-retained protein feature among the 13 regional features. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
| Hgene | DCPS | chr11:126176639 | chr11:69462761 | ENST00000263579 | + | 2 | 6 | 142_154 | 125.33333333333333 | 338.0 | Motif | Note=nuclear export sequence (NES) |
| Hgene | DCPS | chr11:126176639 | chr11:69462761 | ENST00000263579 | + | 2 | 6 | 275_279 | 125.33333333333333 | 338.0 | Motif | Note=Histidine triad motif |
| Hgene | DCPS | chr11:126176639 | chr11:69462762 | ENST00000263579 | + | 2 | 6 | 142_154 | 125.33333333333333 | 338.0 | Motif | Note=nuclear export sequence (NES) |
| Hgene | DCPS | chr11:126176639 | chr11:69462762 | ENST00000263579 | + | 2 | 6 | 275_279 | 125.33333333333333 | 338.0 | Motif | Note=Histidine triad motif |
| Hgene | DCPS | chr11:126176639 | chr11:69462761 | ENST00000263579 | + | 2 | 6 | 268_279 | 125.33333333333333 | 338.0 | Region | Note=Substrate binding |
| Hgene | DCPS | chr11:126176639 | chr11:69462762 | ENST00000263579 | + | 2 | 6 | 268_279 | 125.33333333333333 | 338.0 | Region | Note=Substrate binding |
| Tgene | CCND1 | chr11:126176639 | chr11:69462761 | ENST00000227507 | 2 | 5 | 28_152 | 191.33333333333334 | 296.0 | Domain | Note=Cyclin N-terminal | |
| Tgene | CCND1 | chr11:126176639 | chr11:69462762 | ENST00000227507 | 2 | 5 | 28_152 | 191.33333333333334 | 296.0 | Domain | Note=Cyclin N-terminal |
Top |
Fusion Protein-Protein Interaction |
| Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in |
| Protein-protein interactors with each fusion partner protein in wild-type from validated records (BIOGRID-3.4.160) |
| Gene | PPI interactors |
| Protein-protein interactors based on sequence similarity (STRING) |
| Gene | STRING network |
| DCPS | |
| CCND1 |
| - Retained interactions in fusion protein (protein functional feature from UniProt). |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
| - Lost interactions due to fusion (protein functional feature from UniProt). |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
Related Drugs to DCPS-CCND1 |
| Drugs used for this fusion-positive patient. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
| Hgene | Tgene | Drug | Source | PMID |
Top |
Related Diseases to DCPS-CCND1 |
| Diseases that have this fusion gene. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
| Hgene | Tgene | Disease | Source | PMID |
| Diseases associated with fusion partners. (DisGeNet 4.0) |
| Partner | Gene | Disease ID | Disease name | # pubmeds | Source |
Copyright 2021-Present -The University of Texas Health Science Center at Houston (UTHealth)
Web File Viewing | Emergency Information |Campus Carry|Site Policies