| UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
|
|||||||
|
Fusion Protein:DDX58-TCERG1L |
Fusion Protein Summary |
 Fusion gene summary |
| Fusion partner gene information | Fusion gene name: DDX58-TCERG1L | FusionPDB ID: 22062 | FusionGDB2.0 ID: 22062 | Hgene | Tgene | Gene symbol | DDX58 | TCERG1L | Gene ID | 23586 | 256536 |
| Gene name | DExD/H-box helicase 58 | transcription elongation regulator 1 like | |
| Synonyms | RIG-I|RIG1|RIGI|RLR-1|SGMRT2 | - | |
| Cytomap | 9p21.1 | 10q26.3 | |
| Type of gene | protein-coding | protein-coding | |
| Description | probable ATP-dependent RNA helicase DDX58DEAD (Asp-Glu-Ala-Asp) box polypeptide 58DEAD box protein 58DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptideRNA helicase RIG-Iretinoic acid-inducible gene 1 proteinretinoic acid-inducible gene I protein | transcription elongation regulator 1-like protein5730476P14Rik | |
| Modification date | 20200329 | 20200313 | |
| UniProtAcc | O95786 | . | |
| Ensembl transtripts involved in fusion gene | ENST ids | ENST00000379868, ENST00000545044, ENST00000379882, ENST00000379883, ENST00000542096, | ENST00000368642, |
| Fusion gene scores for assessment (based on all fusion genes of FusionGDB 2.0) | * DoF score | 7 X 7 X 6=294 | 8 X 6 X 6=288 |
| # samples | 9 | 9 | |
| ** MAII score | log2(9/294*10)=-1.70781924850669 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | log2(9/288*10)=-1.67807190511264 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | |
| Context (manual curation of fusion genes in FusionPDB) | PubMed: DDX58 [Title/Abstract] AND TCERG1L [Title/Abstract] AND fusion [Title/Abstract] | ||
| Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) | DDX58(32526058)-TCERG1L(132902617), # samples:1 DDX58(32526059)-TCERG1L(132902617), # samples:1 | ||
| Anticipated loss of major functional domain due to fusion event. | DDX58-TCERG1L seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. DDX58-TCERG1L seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. DDX58-TCERG1L seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. DDX58-TCERG1L seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. | ||
| * DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
| Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Partner | Gene | GO ID | GO term | PubMed ID |
| Hgene | DDX58 | GO:0009597 | detection of virus | 17079289 |
| Hgene | DDX58 | GO:0010628 | positive regulation of gene expression | 24409285 |
| Hgene | DDX58 | GO:0030334 | regulation of cell migration | 19122199 |
| Hgene | DDX58 | GO:0032725 | positive regulation of granulocyte macrophage colony-stimulating factor production | 24409285 |
| Hgene | DDX58 | GO:0032727 | positive regulation of interferon-alpha production | 19576794 |
| Hgene | DDX58 | GO:0032728 | positive regulation of interferon-beta production | 17079289 |
| Hgene | DDX58 | GO:0032755 | positive regulation of interleukin-6 production | 24409285 |
| Hgene | DDX58 | GO:0032757 | positive regulation of interleukin-8 production | 24409285 |
| Hgene | DDX58 | GO:0039529 | RIG-I signaling pathway | 28469175 |
| Hgene | DDX58 | GO:0045944 | positive regulation of transcription by RNA polymerase II | 17079289 |
| Hgene | DDX58 | GO:0051091 | positive regulation of DNA-binding transcription factor activity | 17079289 |
| Hgene | DDX58 | GO:0051607 | defense response to virus | 21478870 |
| Fusion gene breakpoints across DDX58 (5'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
 |
| Fusion gene breakpoints across TCERG1L (3'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
 |
Top |
Fusion Gene Sample Information |
| Fusion gene information from FusionGDB2.0. |
| Fusion gene information from two resources (ChiTars 5.0 and ChimerDB 4.0) * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
| Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
| ChimerDB4 | LUAD | TCGA-86-7713-01A | DDX58 | chr9 | 32526059 | - | TCERG1L | chr10 | 132902617 | - |
| ChimerDB4 | LUAD | TCGA-86-7713 | DDX58 | chr9 | 32526058 | - | TCERG1L | chr10 | 132902617 | - |
Top |
Fusion ORF Analysis |
| Fusion information from ORFfinder translation from full-length transcript sequence from FusionPDB. |
| Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
| ENST00000379882 | DDX58 | chr9 | 32526058 | - | ENST00000368642 | TCERG1L | chr10 | 132902617 | - | 1401 | 264 | 327 | 629 | 100 |
| ENST00000379883 | DDX58 | chr9 | 32526058 | - | ENST00000368642 | TCERG1L | chr10 | 132902617 | - | 1401 | 264 | 327 | 629 | 100 |
| ENST00000379882 | DDX58 | chr9 | 32526059 | - | ENST00000368642 | TCERG1L | chr10 | 132902617 | - | 1401 | 264 | 327 | 629 | 100 |
| ENST00000379883 | DDX58 | chr9 | 32526059 | - | ENST00000368642 | TCERG1L | chr10 | 132902617 | - | 1401 | 264 | 327 | 629 | 100 |
| DeepORF prediction of the coding potential based on the fusion transcript sequence of in-frame fusion genes. DeepORF is a coding potential classifier based on convolutional neural network by comparing the real Ribo-seq data. If the no-coding score < 0.5 and coding score > 0.5, then the in-frame fusion transcript is predicted as being likely translated. |
| Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
| ENST00000379882 | ENST00000368642 | DDX58 | chr9 | 32526058 | - | TCERG1L | chr10 | 132902617 | - | 0.71898067 | 0.28101933 |
| ENST00000379883 | ENST00000368642 | DDX58 | chr9 | 32526058 | - | TCERG1L | chr10 | 132902617 | - | 0.71898067 | 0.28101933 |
| ENST00000379882 | ENST00000368642 | DDX58 | chr9 | 32526059 | - | TCERG1L | chr10 | 132902617 | - | 0.71898067 | 0.28101933 |
| ENST00000379883 | ENST00000368642 | DDX58 | chr9 | 32526059 | - | TCERG1L | chr10 | 132902617 | - | 0.71898067 | 0.28101933 |
Top |
Fusion Amino Acid Sequences |
| For individual full-length fusion transcript sequence from FusionPDB, we ran ORFfinder and chose the longest ORF among the all predicted ones. |
| >FusionGDB ID_FusionGDB isoform ID_FGname_Hgene_Hchr_Hbp_Henst_Tgene_Tchr_Tbp_Tenst_length(fusion AA) seq_BP >22062_22062_1_DDX58-TCERG1L_DDX58_chr9_32526058_ENST00000379882_TCERG1L_chr10_132902617_ENST00000368642_length(amino acids)=100AA_BP= MLNSEERKQIFEQFVKTRIKEEYKEKKSKLLLAKEEFKKLLEESKVSPRTTFKEFAEKYGRDQRFRLVQKRKDQEHFFNQFILILKKRDK -------------------------------------------------------------- >22062_22062_2_DDX58-TCERG1L_DDX58_chr9_32526058_ENST00000379883_TCERG1L_chr10_132902617_ENST00000368642_length(amino acids)=100AA_BP= MLNSEERKQIFEQFVKTRIKEEYKEKKSKLLLAKEEFKKLLEESKVSPRTTFKEFAEKYGRDQRFRLVQKRKDQEHFFNQFILILKKRDK -------------------------------------------------------------- >22062_22062_3_DDX58-TCERG1L_DDX58_chr9_32526059_ENST00000379882_TCERG1L_chr10_132902617_ENST00000368642_length(amino acids)=100AA_BP= MLNSEERKQIFEQFVKTRIKEEYKEKKSKLLLAKEEFKKLLEESKVSPRTTFKEFAEKYGRDQRFRLVQKRKDQEHFFNQFILILKKRDK -------------------------------------------------------------- >22062_22062_4_DDX58-TCERG1L_DDX58_chr9_32526059_ENST00000379883_TCERG1L_chr10_132902617_ENST00000368642_length(amino acids)=100AA_BP= MLNSEERKQIFEQFVKTRIKEEYKEKKSKLLLAKEEFKKLLEESKVSPRTTFKEFAEKYGRDQRFRLVQKRKDQEHFFNQFILILKKRDK -------------------------------------------------------------- |
Top |
Fusion Protein Functional Features |
| Four levels of functional features of fusion genes Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr9:32526058/chr10:132902617) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
 |
| Main function of each fusion partner protein. (from UniProt) |
| Hgene | Tgene |
| DDX58 | . |
| FUNCTION: Innate immune receptor that senses cytoplasmic viral nucleic acids and activates a downstream signaling cascade leading to the production of type I interferons and proinflammatory cytokines. Forms a ribonucleoprotein complex with viral RNAs on which it homooligomerizes to form filaments. The homooligomerization allows the recruitment of RNF135 an E3 ubiquitin-protein ligase that activates and amplifies the RIG-I-mediated antiviral signaling in an RNA length-dependent manner through ubiquitination-dependent and -independent mechanisms (PubMed:28469175, PubMed:31006531). Upon activation, associates with mitochondria antiviral signaling protein (MAVS/IPS1) that activates the IKK-related kinases TBK1 and IKBKE which in turn phosphorylate the interferon regulatory factors IRF3 and IRF7, activating transcription of antiviral immunological genes including the IFN-alpha and IFN-beta interferons (PubMed:28469175, PubMed:31006531). Ligands include 5'-triphosphorylated ssRNAs and dsRNAs but also short dsRNAs (<1 kb in length). In addition to the 5'-triphosphate moiety, blunt-end base pairing at the 5'-end of the RNA is very essential. Overhangs at the non-triphosphorylated end of the dsRNA RNA have no major impact on its activity. A 3'overhang at the 5'triphosphate end decreases and any 5'overhang at the 5' triphosphate end abolishes its activity. Detects both positive and negative strand RNA viruses including members of the families Paramyxoviridae: Human respiratory syncytial virus and measles virus (MeV), Rhabdoviridae: vesicular stomatitis virus (VSV), Orthomyxoviridae: influenza A and B virus, Flaviviridae: Japanese encephalitis virus (JEV), hepatitis C virus (HCV), dengue virus (DENV) and west Nile virus (WNV). It also detects rotaviruses and reoviruses. Also involved in antiviral signaling in response to viruses containing a dsDNA genome such as Epstein-Barr virus (EBV). Detects dsRNA produced from non-self dsDNA by RNA polymerase III, such as Epstein-Barr virus-encoded RNAs (EBERs). May play important roles in granulocyte production and differentiation, bacterial phagocytosis and in the regulation of cell migration. {ECO:0000269|PubMed:15208624, ECO:0000269|PubMed:15708988, ECO:0000269|PubMed:16125763, ECO:0000269|PubMed:16127453, ECO:0000269|PubMed:16153868, ECO:0000269|PubMed:17190814, ECO:0000269|PubMed:18636086, ECO:0000269|PubMed:19122199, ECO:0000269|PubMed:19211564, ECO:0000269|PubMed:19576794, ECO:0000269|PubMed:19609254, ECO:0000269|PubMed:19631370, ECO:0000269|PubMed:21742966, ECO:0000269|PubMed:28469175, ECO:0000269|PubMed:29117565, ECO:0000269|PubMed:31006531}. | FUNCTION: Might normally function as a transcriptional repressor. EWS-fusion-proteins (EFPS) may play a role in the tumorigenic process. They may disturb gene expression by mimicking, or interfering with the normal function of CTD-POLII within the transcription initiation complex. They may also contribute to an aberrant activation of the fusion protein target genes. |
| Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
| - Retained protein feature among the 13 regional features. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
| Tgene | TCERG1L | chr9:32526058 | chr10:132902617 | ENST00000368642 | 8 | 12 | 515_570 | 465.0 | 587.0 | Domain | Note=FF 2 | |
| Tgene | TCERG1L | chr9:32526059 | chr10:132902617 | ENST00000368642 | 8 | 12 | 515_570 | 465.0 | 587.0 | Domain | Note=FF 2 |
| - Not-retained protein feature among the 13 regional features. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
| Hgene | DDX58 | chr9:32526058 | chr10:132902617 | ENST00000379882 | - | 1 | 17 | 1_87 | 35.333333333333336 | 881.0 | Domain | Note=CARD 1 |
| Hgene | DDX58 | chr9:32526058 | chr10:132902617 | ENST00000379882 | - | 1 | 17 | 251_430 | 35.333333333333336 | 881.0 | Domain | Helicase ATP-binding |
| Hgene | DDX58 | chr9:32526058 | chr10:132902617 | ENST00000379882 | - | 1 | 17 | 610_776 | 35.333333333333336 | 881.0 | Domain | Helicase C-terminal |
| Hgene | DDX58 | chr9:32526058 | chr10:132902617 | ENST00000379882 | - | 1 | 17 | 794_925 | 35.333333333333336 | 881.0 | Domain | RLR CTR |
| Hgene | DDX58 | chr9:32526058 | chr10:132902617 | ENST00000379882 | - | 1 | 17 | 92_172 | 35.333333333333336 | 881.0 | Domain | Note=CARD 2 |
| Hgene | DDX58 | chr9:32526058 | chr10:132902617 | ENST00000379883 | - | 1 | 18 | 1_87 | 35.333333333333336 | 926.0 | Domain | Note=CARD 1 |
| Hgene | DDX58 | chr9:32526058 | chr10:132902617 | ENST00000379883 | - | 1 | 18 | 251_430 | 35.333333333333336 | 926.0 | Domain | Helicase ATP-binding |
| Hgene | DDX58 | chr9:32526058 | chr10:132902617 | ENST00000379883 | - | 1 | 18 | 610_776 | 35.333333333333336 | 926.0 | Domain | Helicase C-terminal |
| Hgene | DDX58 | chr9:32526058 | chr10:132902617 | ENST00000379883 | - | 1 | 18 | 794_925 | 35.333333333333336 | 926.0 | Domain | RLR CTR |
| Hgene | DDX58 | chr9:32526058 | chr10:132902617 | ENST00000379883 | - | 1 | 18 | 92_172 | 35.333333333333336 | 926.0 | Domain | Note=CARD 2 |
| Hgene | DDX58 | chr9:32526059 | chr10:132902617 | ENST00000379882 | - | 1 | 17 | 1_87 | 35.333333333333336 | 881.0 | Domain | Note=CARD 1 |
| Hgene | DDX58 | chr9:32526059 | chr10:132902617 | ENST00000379882 | - | 1 | 17 | 251_430 | 35.333333333333336 | 881.0 | Domain | Helicase ATP-binding |
| Hgene | DDX58 | chr9:32526059 | chr10:132902617 | ENST00000379882 | - | 1 | 17 | 610_776 | 35.333333333333336 | 881.0 | Domain | Helicase C-terminal |
| Hgene | DDX58 | chr9:32526059 | chr10:132902617 | ENST00000379882 | - | 1 | 17 | 794_925 | 35.333333333333336 | 881.0 | Domain | RLR CTR |
| Hgene | DDX58 | chr9:32526059 | chr10:132902617 | ENST00000379882 | - | 1 | 17 | 92_172 | 35.333333333333336 | 881.0 | Domain | Note=CARD 2 |
| Hgene | DDX58 | chr9:32526059 | chr10:132902617 | ENST00000379883 | - | 1 | 18 | 1_87 | 35.333333333333336 | 926.0 | Domain | Note=CARD 1 |
| Hgene | DDX58 | chr9:32526059 | chr10:132902617 | ENST00000379883 | - | 1 | 18 | 251_430 | 35.333333333333336 | 926.0 | Domain | Helicase ATP-binding |
| Hgene | DDX58 | chr9:32526059 | chr10:132902617 | ENST00000379883 | - | 1 | 18 | 610_776 | 35.333333333333336 | 926.0 | Domain | Helicase C-terminal |
| Hgene | DDX58 | chr9:32526059 | chr10:132902617 | ENST00000379883 | - | 1 | 18 | 794_925 | 35.333333333333336 | 926.0 | Domain | RLR CTR |
| Hgene | DDX58 | chr9:32526059 | chr10:132902617 | ENST00000379883 | - | 1 | 18 | 92_172 | 35.333333333333336 | 926.0 | Domain | Note=CARD 2 |
| Hgene | DDX58 | chr9:32526058 | chr10:132902617 | ENST00000379882 | - | 1 | 17 | 372_375 | 35.333333333333336 | 881.0 | Motif | Note=DECH box |
| Hgene | DDX58 | chr9:32526058 | chr10:132902617 | ENST00000379883 | - | 1 | 18 | 372_375 | 35.333333333333336 | 926.0 | Motif | Note=DECH box |
| Hgene | DDX58 | chr9:32526059 | chr10:132902617 | ENST00000379882 | - | 1 | 17 | 372_375 | 35.333333333333336 | 881.0 | Motif | Note=DECH box |
| Hgene | DDX58 | chr9:32526059 | chr10:132902617 | ENST00000379883 | - | 1 | 18 | 372_375 | 35.333333333333336 | 926.0 | Motif | Note=DECH box |
| Hgene | DDX58 | chr9:32526058 | chr10:132902617 | ENST00000379882 | - | 1 | 17 | 264_271 | 35.333333333333336 | 881.0 | Nucleotide binding | ATP |
| Hgene | DDX58 | chr9:32526058 | chr10:132902617 | ENST00000379883 | - | 1 | 18 | 264_271 | 35.333333333333336 | 926.0 | Nucleotide binding | ATP |
| Hgene | DDX58 | chr9:32526059 | chr10:132902617 | ENST00000379882 | - | 1 | 17 | 264_271 | 35.333333333333336 | 881.0 | Nucleotide binding | ATP |
| Hgene | DDX58 | chr9:32526059 | chr10:132902617 | ENST00000379883 | - | 1 | 18 | 264_271 | 35.333333333333336 | 926.0 | Nucleotide binding | ATP |
| Tgene | TCERG1L | chr9:32526058 | chr10:132902617 | ENST00000368642 | 8 | 12 | 100_105 | 465.0 | 587.0 | Compositional bias | Note=Poly-Ala | |
| Tgene | TCERG1L | chr9:32526058 | chr10:132902617 | ENST00000368642 | 8 | 12 | 237_247 | 465.0 | 587.0 | Compositional bias | Note=Poly-Ala | |
| Tgene | TCERG1L | chr9:32526059 | chr10:132902617 | ENST00000368642 | 8 | 12 | 100_105 | 465.0 | 587.0 | Compositional bias | Note=Poly-Ala | |
| Tgene | TCERG1L | chr9:32526059 | chr10:132902617 | ENST00000368642 | 8 | 12 | 237_247 | 465.0 | 587.0 | Compositional bias | Note=Poly-Ala | |
| Tgene | TCERG1L | chr9:32526058 | chr10:132902617 | ENST00000368642 | 8 | 12 | 148_181 | 465.0 | 587.0 | Domain | WW 1 | |
| Tgene | TCERG1L | chr9:32526058 | chr10:132902617 | ENST00000368642 | 8 | 12 | 339_372 | 465.0 | 587.0 | Domain | WW 2 | |
| Tgene | TCERG1L | chr9:32526058 | chr10:132902617 | ENST00000368642 | 8 | 12 | 450_503 | 465.0 | 587.0 | Domain | Note=FF 1 | |
| Tgene | TCERG1L | chr9:32526059 | chr10:132902617 | ENST00000368642 | 8 | 12 | 148_181 | 465.0 | 587.0 | Domain | WW 1 | |
| Tgene | TCERG1L | chr9:32526059 | chr10:132902617 | ENST00000368642 | 8 | 12 | 339_372 | 465.0 | 587.0 | Domain | WW 2 | |
| Tgene | TCERG1L | chr9:32526059 | chr10:132902617 | ENST00000368642 | 8 | 12 | 450_503 | 465.0 | 587.0 | Domain | Note=FF 1 |
Top |
Fusion Protein-Protein Interaction |
| Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in |
| Protein-protein interactors with each fusion partner protein in wild-type from validated records (BIOGRID-3.4.160) |
| Gene | PPI interactors |
| Protein-protein interactors based on sequence similarity (STRING) |
| Gene | STRING network |
| DDX58 | |
| TCERG1L |
| - Retained interactions in fusion protein (protein functional feature from UniProt). |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
| - Lost interactions due to fusion (protein functional feature from UniProt). |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
| Hgene | DDX58 | chr9:32526058 | chr10:132902617 | ENST00000379882 | - | 1 | 17 | 218_925 | 35.333333333333336 | 881.0 | ZC3HAV1 |
| Hgene | DDX58 | chr9:32526058 | chr10:132902617 | ENST00000379883 | - | 1 | 18 | 218_925 | 35.333333333333336 | 926.0 | ZC3HAV1 |
| Hgene | DDX58 | chr9:32526059 | chr10:132902617 | ENST00000379882 | - | 1 | 17 | 218_925 | 35.333333333333336 | 881.0 | ZC3HAV1 |
| Hgene | DDX58 | chr9:32526059 | chr10:132902617 | ENST00000379883 | - | 1 | 18 | 218_925 | 35.333333333333336 | 926.0 | ZC3HAV1 |
Top |
Related Drugs to DDX58-TCERG1L |
| Drugs used for this fusion-positive patient. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
| Hgene | Tgene | Drug | Source | PMID |
Top |
Related Diseases to DDX58-TCERG1L |
| Diseases that have this fusion gene. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
| Hgene | Tgene | Disease | Source | PMID |
| Diseases associated with fusion partners. (DisGeNet 4.0) |
| Partner | Gene | Disease ID | Disease name | # pubmeds | Source |
Copyright 2021-Present -The University of Texas Health Science Center at Houston (UTHealth)
Web File Viewing | Emergency Information |Campus Carry|Site Policies