| UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
|
|||||||
|
Fusion Protein:DENND4A-DPP8 |
Fusion Protein Summary |
 Fusion gene summary |
| Fusion partner gene information | Fusion gene name: DENND4A-DPP8 | FusionPDB ID: 22241 | FusionGDB2.0 ID: 22241 | Hgene | Tgene | Gene symbol | DENND4A | DPP8 | Gene ID | 10260 | 54878 |
| Gene name | DENN domain containing 4A | dipeptidyl peptidase 8 | |
| Synonyms | IRLB|MYCPBP | DP8|DPRP-1|DPRP1|MST097|MSTP097|MSTP135|MSTP141 | |
| Cytomap | 15q22.31 | 15q22.31 | |
| Type of gene | protein-coding | protein-coding | |
| Description | C-myc promoter-binding proteinDENN domain-containing protein 4ADENN/MADD domain containing 4Ac-myc promoter binding protein | dipeptidyl peptidase 8DPP VIIIdipeptidyl peptidase IV-related protein 1dipeptidyl peptidase VIIIprolyl dipeptidase DPP8 | |
| Modification date | 20200313 | 20200313 | |
| UniProtAcc | Q7Z401 | Q6V1X1 | |
| Ensembl transtripts involved in fusion gene | ENST ids | ENST00000431932, ENST00000443035, ENST00000567323, | ENST00000300141, ENST00000321118, ENST00000321147, ENST00000339244, ENST00000358939, ENST00000559233, ENST00000560048, ENST00000341861, |
| Fusion gene scores for assessment (based on all fusion genes of FusionGDB 2.0) | * DoF score | 11 X 12 X 8=1056 | 5 X 6 X 4=120 |
| # samples | 14 | 6 | |
| ** MAII score | log2(14/1056*10)=-2.91511110241349 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | log2(6/120*10)=-1 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | |
| Context (manual curation of fusion genes in FusionPDB) | PubMed: DENND4A [Title/Abstract] AND DPP8 [Title/Abstract] AND fusion [Title/Abstract] | ||
| Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) | DENND4A(66021410)-DPP8(65804902), # samples:2 | ||
| Anticipated loss of major functional domain due to fusion event. | DENND4A-DPP8 seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. DENND4A-DPP8 seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. DENND4A-DPP8 seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. DENND4A-DPP8 seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. DENND4A-DPP8 seems lost the major protein functional domain in Hgene partner, which is a essential gene due to the frame-shifted ORF. DENND4A-DPP8 seems lost the major protein functional domain in Tgene partner, which is a essential gene due to the frame-shifted ORF. DENND4A-DPP8 seems lost the major protein functional domain in Tgene partner, which is a IUPHAR drug target due to the frame-shifted ORF. | ||
| * DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
| Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Partner | Gene | GO ID | GO term | PubMed ID |
| Fusion gene breakpoints across DENND4A (5'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
 |
| Fusion gene breakpoints across DPP8 (3'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
 |
Top |
Fusion Gene Sample Information |
| Fusion gene information from FusionGDB2.0. |
| Fusion gene information from two resources (ChiTars 5.0 and ChimerDB 4.0) * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
| Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
| ChimerDB4 | LIHC | TCGA-RC-A6M3-01A | DENND4A | chr15 | 66021410 | - | DPP8 | chr15 | 65804902 | - |
Top |
Fusion ORF Analysis |
| Fusion information from ORFfinder translation from full-length transcript sequence from FusionPDB. |
| Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
| ENST00000443035 | DENND4A | chr15 | 66021410 | - | ENST00000341861 | DPP8 | chr15 | 65804902 | - | 8784 | 1703 | 1714 | 4362 | 882 |
| DeepORF prediction of the coding potential based on the fusion transcript sequence of in-frame fusion genes. DeepORF is a coding potential classifier based on convolutional neural network by comparing the real Ribo-seq data. If the no-coding score < 0.5 and coding score > 0.5, then the in-frame fusion transcript is predicted as being likely translated. |
| Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
| ENST00000443035 | ENST00000341861 | DENND4A | chr15 | 66021410 | - | DPP8 | chr15 | 65804902 | - | 0.000122582 | 0.99987745 |
Top |
Fusion Amino Acid Sequences |
| For individual full-length fusion transcript sequence from FusionPDB, we ran ORFfinder and chose the longest ORF among the all predicted ones. |
| >FusionGDB ID_FusionGDB isoform ID_FGname_Hgene_Hchr_Hbp_Henst_Tgene_Tchr_Tbp_Tenst_length(fusion AA) seq_BP >22241_22241_1_DENND4A-DPP8_DENND4A_chr15_66021410_ENST00000443035_DPP8_chr15_65804902_ENST00000341861_length(amino acids)=882AA_BP= MAAAMETEQLGVEIFETADCEENIESQDRPKLEPFYVERYSWSQLKKLLADTRKYHGYMMAKAPHDFMFVKRNDPDGPHSDRIYYLAMSG ENRENTLFYSEIPKTINRAAVLMLSWKPLLDLFQATLDYGMYSREEELLRERKRIGTVGIASYDYHQGSGTFLFQAGSGIYHVKDGGPQG FTQQPLRPNLVETSCPNIRMDPKLCPADPDWIAFIHSNDIWISNIVTREERRLTYVHNELANMEEDARSAGVATFVLQEEFDRYSGYWWC PKAETTPSGGKILRILYEENDESEVEIIHVTSPMLETRRADSFRYPKTGTANPKVTFKMSEIMIDAEGRIIDVIDKELIQPFEILFEGVE YIARAGWTPEGKYAWSILLDRSQTRLQIVLISPELFIPVEDDVMERQRLIESVPDSVTPLIIYEETTDIWINIHDIFHVFPQSHEEEIEF IFASECKTGFRHLYKITSILKESKYKRSSGGLPAPSDFKCPIKEEIAITSGEWEVLGRHGSNIQVDEVRRLVYFEGTKDSPLEHHLYVVS YVNPGEVTRLTDRGYSHSCCISQHCDFFISKYSNQKNPHCVSLYKLSSPEDDPTCKTKEFWATILDSAGPLPDYTPPEIFSFESTTGFTL YGMLYKPHDLQPGKKYPTVLFIYGGPQVQLVNNRFKGVKYFRLNTLASLGYVVVVIDNRGSCHRGLKFEGAFKYKMGQIEIDDQVEGLQY LASRYDFIDLDRVGIHGWSYGGYLSLMALMQRSDIFRVAIAGAPVTLWIFYDTGYTERYMGHPDQNEQGYYLGSVAMQAEKFPSEPNRLL -------------------------------------------------------------- |
Top |
Fusion Protein Functional Features |
| Four levels of functional features of fusion genes Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr15:66021410/chr15:65804902) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
 |
| Main function of each fusion partner protein. (from UniProt) |
| Hgene | Tgene |
| DENND4A | DPP8 |
| FUNCTION: Probable guanine nucleotide exchange factor (GEF) which may activate RAB10. Promotes the exchange of GDP to GTP, converting inactive GDP-bound Rab proteins into their active GTP-bound form. According to PubMed:8056341, it may bind to ISRE-like element (interferon-stimulated response element) of MYC P2 promoter. {ECO:0000269|PubMed:20937701, ECO:0000269|PubMed:8056341}. | FUNCTION: Dipeptidyl peptidase that cleaves off N-terminal dipeptides from proteins having a Pro or Ala residue at position 2. {ECO:0000269|PubMed:11012666, ECO:0000269|PubMed:12534281, ECO:0000269|PubMed:12662155, ECO:0000269|PubMed:15039077, ECO:0000269|PubMed:15664838, ECO:0000269|PubMed:20536396, ECO:0000305|PubMed:29382749}. |
| Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
| - Retained protein feature among the 13 regional features. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
| Hgene | DENND4A | chr15:66021410 | chr15:65804902 | ENST00000431932 | - | 11 | 32 | 192_364 | 495.6666666666667 | 1864.0 | Domain | uDENN |
| Hgene | DENND4A | chr15:66021410 | chr15:65804902 | ENST00000431932 | - | 11 | 32 | 42_200 | 495.6666666666667 | 1864.0 | Domain | MABP |
| Hgene | DENND4A | chr15:66021410 | chr15:65804902 | ENST00000443035 | - | 11 | 33 | 192_364 | 495.6666666666667 | 1907.0 | Domain | uDENN |
| Hgene | DENND4A | chr15:66021410 | chr15:65804902 | ENST00000443035 | - | 11 | 33 | 42_200 | 495.6666666666667 | 1907.0 | Domain | MABP |
| - Not-retained protein feature among the 13 regional features. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
| Hgene | DENND4A | chr15:66021410 | chr15:65804902 | ENST00000431932 | - | 11 | 32 | 1183_1189 | 495.6666666666667 | 1864.0 | Compositional bias | Note=Poly-Glu |
| Hgene | DENND4A | chr15:66021410 | chr15:65804902 | ENST00000443035 | - | 11 | 33 | 1183_1189 | 495.6666666666667 | 1907.0 | Compositional bias | Note=Poly-Glu |
| Hgene | DENND4A | chr15:66021410 | chr15:65804902 | ENST00000431932 | - | 11 | 32 | 385_521 | 495.6666666666667 | 1864.0 | Domain | cDENN |
| Hgene | DENND4A | chr15:66021410 | chr15:65804902 | ENST00000431932 | - | 11 | 32 | 523_641 | 495.6666666666667 | 1864.0 | Domain | dDENN |
| Hgene | DENND4A | chr15:66021410 | chr15:65804902 | ENST00000443035 | - | 11 | 33 | 385_521 | 495.6666666666667 | 1907.0 | Domain | cDENN |
| Hgene | DENND4A | chr15:66021410 | chr15:65804902 | ENST00000443035 | - | 11 | 33 | 523_641 | 495.6666666666667 | 1907.0 | Domain | dDENN |
| Hgene | DENND4A | chr15:66021410 | chr15:65804902 | ENST00000431932 | - | 11 | 32 | 917_933 | 495.6666666666667 | 1864.0 | Motif | Bipartite nuclear localization signal |
| Hgene | DENND4A | chr15:66021410 | chr15:65804902 | ENST00000443035 | - | 11 | 33 | 917_933 | 495.6666666666667 | 1907.0 | Motif | Bipartite nuclear localization signal |
| Hgene | DENND4A | chr15:66021410 | chr15:65804902 | ENST00000431932 | - | 11 | 32 | 772_808 | 495.6666666666667 | 1864.0 | Repeat | Note=PPR 1 |
| Hgene | DENND4A | chr15:66021410 | chr15:65804902 | ENST00000431932 | - | 11 | 32 | 809_843 | 495.6666666666667 | 1864.0 | Repeat | Note=PPR 2 |
| Hgene | DENND4A | chr15:66021410 | chr15:65804902 | ENST00000443035 | - | 11 | 33 | 772_808 | 495.6666666666667 | 1907.0 | Repeat | Note=PPR 1 |
| Hgene | DENND4A | chr15:66021410 | chr15:65804902 | ENST00000443035 | - | 11 | 33 | 809_843 | 495.6666666666667 | 1907.0 | Repeat | Note=PPR 2 |
Top |
Fusion Protein-Protein Interaction |
| Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in |
| Protein-protein interactors with each fusion partner protein in wild-type from validated records (BIOGRID-3.4.160) |
| Gene | PPI interactors |
| Protein-protein interactors based on sequence similarity (STRING) |
| Gene | STRING network |
| DENND4A | |
| DPP8 |
| - Retained interactions in fusion protein (protein functional feature from UniProt). |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
| - Lost interactions due to fusion (protein functional feature from UniProt). |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
Related Drugs to DENND4A-DPP8 |
| Drugs used for this fusion-positive patient. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
| Hgene | Tgene | Drug | Source | PMID |
Top |
Related Diseases to DENND4A-DPP8 |
| Diseases that have this fusion gene. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
| Hgene | Tgene | Disease | Source | PMID |
| Diseases associated with fusion partners. (DisGeNet 4.0) |
| Partner | Gene | Disease ID | Disease name | # pubmeds | Source |
Copyright 2021-Present -The University of Texas Health Science Center at Houston (UTHealth)
Web File Viewing | Emergency Information |Campus Carry|Site Policies