UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
|
Fusion Protein:DPP4-MTX2 |
Fusion Protein Summary |
Fusion gene summary |
Fusion partner gene information | Fusion gene name: DPP4-MTX2 | FusionPDB ID: 24021 | FusionGDB2.0 ID: 24021 | Hgene | Tgene | Gene symbol | DPP4 | MTX2 | Gene ID | 1803 | 10651 |
Gene name | dipeptidyl peptidase 4 | metaxin 2 | |
Synonyms | ADABP|ADCP2|CD26|DPPIV|TP103 | - | |
Cytomap | 2q24.2 | 2q31.1 | |
Type of gene | protein-coding | protein-coding | |
Description | dipeptidyl peptidase 4ADCP-2DPP IVT-cell activation antigen CD26adenosine deaminase complexing protein 2dipeptidyl peptidase IVdipeptidylpeptidase 4dipeptidylpeptidase IV (CD26, adenosine deaminase complexing protein 2) | metaxin-2mitochondrial outer membrane import complex protein 2 | |
Modification date | 20200322 | 20200327 | |
UniProtAcc | P27487 | O75431 | |
Ensembl transtripts involved in fusion gene | ENST ids | ENST00000360534, ENST00000491591, | ENST00000443241, ENST00000249442, ENST00000392529, |
Fusion gene scores for assessment (based on all fusion genes of FusionGDB 2.0) | * DoF score | 5 X 5 X 4=100 | 11 X 5 X 8=440 |
# samples | 6 | 12 | |
** MAII score | log2(6/100*10)=-0.736965594166206 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | log2(12/440*10)=-1.87446911791614 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | |
Context (manual curation of fusion genes in FusionPDB) | PubMed: DPP4 [Title/Abstract] AND MTX2 [Title/Abstract] AND fusion [Title/Abstract] | ||
Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) | DPP4(162929909)-MTX2(177161588), # samples:1 | ||
Anticipated loss of major functional domain due to fusion event. |
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
Partner | Gene | GO ID | GO term | PubMed ID |
Hgene | DPP4 | GO:0001666 | response to hypoxia | 16670267 |
Hgene | DPP4 | GO:0006508 | proteolysis | 27198182 |
Hgene | DPP4 | GO:0008284 | positive regulation of cell proliferation | 17549790 |
Hgene | DPP4 | GO:0010716 | negative regulation of extracellular matrix disassembly | 16651416 |
Hgene | DPP4 | GO:0031295 | T cell costimulation | 10900005|17287217 |
Hgene | DPP4 | GO:0033632 | regulation of cell-cell adhesion mediated by integrin | 11772392 |
Hgene | DPP4 | GO:0042110 | T cell activation | 7594462 |
Hgene | DPP4 | GO:0043542 | endothelial cell migration | 16651416 |
Fusion gene breakpoints across DPP4 (5'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Fusion gene breakpoints across MTX2 (3'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Top |
Fusion Gene Sample Information |
Fusion gene information from FusionGDB2.0. |
Fusion gene information from two resources (ChiTars 5.0 and ChimerDB 4.0) * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
ChimerDB4 | Non-Cancer | TCGA-BR-7851-11A | DPP4 | chr2 | 162929909 | - | MTX2 | chr2 | 177161588 | + |
Top |
Fusion ORF Analysis |
Fusion information from ORFfinder translation from full-length transcript sequence from FusionPDB. |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
ENST00000360534 | DPP4 | chr2 | 162929909 | - | ENST00000249442 | MTX2 | chr2 | 177161588 | + | 1768 | 655 | 561 | 1406 | 281 |
ENST00000360534 | DPP4 | chr2 | 162929909 | - | ENST00000392529 | MTX2 | chr2 | 177161588 | + | 1761 | 655 | 561 | 1406 | 281 |
DeepORF prediction of the coding potential based on the fusion transcript sequence of in-frame fusion genes. DeepORF is a coding potential classifier based on convolutional neural network by comparing the real Ribo-seq data. If the no-coding score < 0.5 and coding score > 0.5, then the in-frame fusion transcript is predicted as being likely translated. |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
ENST00000360534 | ENST00000249442 | DPP4 | chr2 | 162929909 | - | MTX2 | chr2 | 177161588 | + | 0.000394269 | 0.9996057 |
ENST00000360534 | ENST00000392529 | DPP4 | chr2 | 162929909 | - | MTX2 | chr2 | 177161588 | + | 0.000386099 | 0.99961394 |
Top |
Fusion Amino Acid Sequences |
For individual full-length fusion transcript sequence from FusionPDB, we ran ORFfinder and chose the longest ORF among the all predicted ones. |
>FusionGDB ID_FusionGDB isoform ID_FGname_Hgene_Hchr_Hbp_Henst_Tgene_Tchr_Tbp_Tenst_length(fusion AA) seq_BP >24021_24021_1_DPP4-MTX2_DPP4_chr2_162929909_ENST00000360534_MTX2_chr2_177161588_ENST00000249442_length(amino acids)=281AA_BP=32 MKTPWKVLLGLLGAAALVTIITVPVVLLNKGTAEPWPENATLYQQLKGEQILLSDNAASLAVQAFLQMCNLPIKVVCRANAEYMSPSGKV PFIHVGNQVVSELGPIVQFVKAKGHSLSDGLEEVQKAEMKAYMELVNNMLLTAELYLQWCDEATVGEITHARYGSPYPWPLNHILAYQKQ WEVKRKMKAIGWGKKTLDQVLEDVDQCCQALSQRLGTQPYFFNKQPTELDALVFGHLYTILTTQLTNDELSEKVKNYSNLLAFCRRIEQH -------------------------------------------------------------- >24021_24021_2_DPP4-MTX2_DPP4_chr2_162929909_ENST00000360534_MTX2_chr2_177161588_ENST00000392529_length(amino acids)=281AA_BP=32 MKTPWKVLLGLLGAAALVTIITVPVVLLNKGTAEPWPENATLYQQLKGEQILLSDNAASLAVQAFLQMCNLPIKVVCRANAEYMSPSGKV PFIHVGNQVVSELGPIVQFVKAKGHSLSDGLEEVQKAEMKAYMELVNNMLLTAELYLQWCDEATVGEITHARYGSPYPWPLNHILAYQKQ WEVKRKMKAIGWGKKTLDQVLEDVDQCCQALSQRLGTQPYFFNKQPTELDALVFGHLYTILTTQLTNDELSEKVKNYSNLLAFCRRIEQH -------------------------------------------------------------- |
Top |
Fusion Protein Functional Features |
Four levels of functional features of fusion genes Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr2:162929909/chr2:177161588) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
Main function of each fusion partner protein. (from UniProt) |
Hgene | Tgene |
DPP4 | MTX2 |
FUNCTION: Cell surface glycoprotein receptor involved in the costimulatory signal essential for T-cell receptor (TCR)-mediated T-cell activation (PubMed:10951221, PubMed:10900005, PubMed:11772392, PubMed:17287217). Acts as a positive regulator of T-cell coactivation, by binding at least ADA, CAV1, IGF2R, and PTPRC (PubMed:10951221, PubMed:10900005, PubMed:11772392, PubMed:14691230). Its binding to CAV1 and CARD11 induces T-cell proliferation and NF-kappa-B activation in a T-cell receptor/CD3-dependent manner (PubMed:17287217). Its interaction with ADA also regulates lymphocyte-epithelial cell adhesion (PubMed:11772392). In association with FAP is involved in the pericellular proteolysis of the extracellular matrix (ECM), the migration and invasion of endothelial cells into the ECM (PubMed:16651416, PubMed:10593948). May be involved in the promotion of lymphatic endothelial cells adhesion, migration and tube formation (PubMed:18708048). When overexpressed, enhanced cell proliferation, a process inhibited by GPC3 (PubMed:17549790). Acts also as a serine exopeptidase with a dipeptidyl peptidase activity that regulates various physiological processes by cleaving peptides in the circulation, including many chemokines, mitogenic growth factors, neuropeptides and peptide hormones such as brain natriuretic peptide 32 (PubMed:16254193, PubMed:10570924). Removes N-terminal dipeptides sequentially from polypeptides having unsubstituted N-termini provided that the penultimate residue is proline (PubMed:10593948). {ECO:0000269|PubMed:10570924, ECO:0000269|PubMed:10593948, ECO:0000269|PubMed:10900005, ECO:0000269|PubMed:10951221, ECO:0000269|PubMed:11772392, ECO:0000269|PubMed:14691230, ECO:0000269|PubMed:16254193, ECO:0000269|PubMed:16651416, ECO:0000269|PubMed:17287217, ECO:0000269|PubMed:17549790, ECO:0000269|PubMed:18708048}.; FUNCTION: (Microbial infection) Acts as a receptor for human coronavirus MERS-CoV-2. {ECO:0000269|PubMed:23835475}. | FUNCTION: Involved in transport of proteins into the mitochondrion. {ECO:0000269|PubMed:10381257}. |
Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
- Retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Hgene | DPP4 | chr2:162929909 | chr2:177161588 | ENST00000360534 | - | 2 | 26 | 1_6 | 31.333333333333332 | 767.0 | Topological domain | Cytoplasmic |
Hgene | DPP4 | chr2:162929909 | chr2:177161588 | ENST00000360534 | - | 2 | 26 | 7_28 | 31.333333333333332 | 767.0 | Transmembrane | Helical%3B Signal-anchor for type II membrane protein |
- Not-retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Hgene | DPP4 | chr2:162929909 | chr2:177161588 | ENST00000360534 | - | 2 | 26 | 29_766 | 31.333333333333332 | 767.0 | Topological domain | Extracellular |
Top |
Fusion Protein-Protein Interaction |
Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in |
Protein-protein interactors with each fusion partner protein in wild-type from validated records (BIOGRID-3.4.160) |
Gene | PPI interactors |
Protein-protein interactors based on sequence similarity (STRING) |
Gene | STRING network |
DPP4 | |
MTX2 |
- Retained interactions in fusion protein (protein functional feature from UniProt). |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
- Lost interactions due to fusion (protein functional feature from UniProt). |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
Related Drugs to DPP4-MTX2 |
Drugs used for this fusion-positive patient. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Drug | Source | PMID |
Top |
Related Diseases to DPP4-MTX2 |
Diseases that have this fusion gene. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Disease | Source | PMID |
Diseases associated with fusion partners. (DisGeNet 4.0) |
Partner | Gene | Disease ID | Disease name | # pubmeds | Source |