UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
![]() |
|||||||
|
Fusion Protein:E2F3-FARS2 |
Fusion Protein Summary |
![]() |
Fusion partner gene information | Fusion gene name: E2F3-FARS2 | FusionPDB ID: 24777 | FusionGDB2.0 ID: 24777 | Hgene | Tgene | Gene symbol | E2F3 | FARS2 | Gene ID | 1871 | 10667 |
Gene name | E2F transcription factor 3 | phenylalanyl-tRNA synthetase 2, mitochondrial | |
Synonyms | E2F-3 | COXPD14|FARS1|HSPC320|PheRS|SPG77|mtPheRS | |
Cytomap | 6p22.3 | 6p25.1 | |
Type of gene | protein-coding | protein-coding | |
Description | transcription factor E2F3 | phenylalanine--tRNA ligase, mitochondrialdJ236A3.1 (phenylalanine-tRNA synthetase)dJ520B18.2 (FARS1 (phenylalanine-tRNA synthetase))mitochondrial PHERSphenylalanine tRNA ligase 2, mitochondrialphenylalanine translasephenylalanine-tRNA synthetase 1 ( | |
Modification date | 20200322 | 20200313 | |
UniProtAcc | O00716 | O95363 | |
Ensembl transtripts involved in fusion gene | ENST ids | ENST00000535432, ENST00000346618, | ENST00000274680, ENST00000324331, |
Fusion gene scores for assessment (based on all fusion genes of FusionGDB 2.0) | * DoF score | 8 X 3 X 5=120 | 15 X 13 X 10=1950 |
# samples | 12 | 21 | |
** MAII score | log2(12/120*10)=0 | log2(21/1950*10)=-3.21501289097085 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | |
Context (manual curation of fusion genes in FusionPDB) | PubMed: E2F3 [Title/Abstract] AND FARS2 [Title/Abstract] AND fusion [Title/Abstract] | ||
Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) | E2F3(20404063)-FARS2(5404774), # samples:2 | ||
Anticipated loss of major functional domain due to fusion event. | E2F3-FARS2 seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. E2F3-FARS2 seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. E2F3-FARS2 seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. E2F3-FARS2 seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. |
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
![]() |
Partner | Gene | GO ID | GO term | PubMed ID |
Hgene | E2F3 | GO:0000082 | G1/S transition of mitotic cell cycle | 17062573 |
Hgene | E2F3 | GO:0006606 | protein import into nucleus | 17062573 |
Hgene | E2F3 | GO:0045944 | positive regulation of transcription by RNA polymerase II | 7739537 |
Tgene | FARS2 | GO:0006432 | phenylalanyl-tRNA aminoacylation | 10329163 |
Tgene | FARS2 | GO:0008033 | tRNA processing | 10329163 |
![]() * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
![]() |
![]() * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
![]() |
Top |
Fusion Gene Sample Information |
![]() |
![]() * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
ChimerDB4 | THCA | TCGA-DJ-A2PU | E2F3 | chr6 | 20404063 | + | FARS2 | chr6 | 5404774 | + |
Top |
Fusion ORF Analysis |
![]() |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
ENST00000535432 | E2F3 | chr6 | 20404063 | + | ENST00000324331 | FARS2 | chr6 | 5404774 | + | 774 | 30 | 0 | 773 | 257 |
ENST00000535432 | E2F3 | chr6 | 20404063 | + | ENST00000274680 | FARS2 | chr6 | 5404774 | + | 925 | 30 | 0 | 773 | 257 |
![]() |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
ENST00000535432 | ENST00000324331 | E2F3 | chr6 | 20404063 | + | FARS2 | chr6 | 5404774 | + | 0.001136052 | 0.99886394 |
ENST00000535432 | ENST00000274680 | E2F3 | chr6 | 20404063 | + | FARS2 | chr6 | 5404774 | + | 0.001610192 | 0.99838984 |
Top |
Fusion Amino Acid Sequences |
![]() |
>FusionGDB ID_FusionGDB isoform ID_FGname_Hgene_Hchr_Hbp_Henst_Tgene_Tchr_Tbp_Tenst_length(fusion AA) seq_BP >24777_24777_1_E2F3-FARS2_E2F3_chr6_20404063_ENST00000535432_FARS2_chr6_5404774_ENST00000274680_length(amino acids)=257AA_BP=9 LVSEMPLQQQLFAGIKDGESLQLFEQSSRSAHKQETHTMEAVKLVEFDLKQTLTRLMAHLFGDELEIRWVDCYFPFTHPSFEMEINFHGE WLEVLGCGVMEQQLVNSAGAQDRIGWAFGLGLERLAMILYDIPDIRLFWCEDERFLKQFCVSNINQKVKFQPLSKYPAVINDISFWLPSE -------------------------------------------------------------- >24777_24777_2_E2F3-FARS2_E2F3_chr6_20404063_ENST00000535432_FARS2_chr6_5404774_ENST00000324331_length(amino acids)=257AA_BP=9 LVSEMPLQQQLFAGIKDGESLQLFEQSSRSAHKQETHTMEAVKLVEFDLKQTLTRLMAHLFGDELEIRWVDCYFPFTHPSFEMEINFHGE WLEVLGCGVMEQQLVNSAGAQDRIGWAFGLGLERLAMILYDIPDIRLFWCEDERFLKQFCVSNINQKVKFQPLSKYPAVINDISFWLPSE -------------------------------------------------------------- |
Top |
Fusion Protein Functional Features |
![]() Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr6:20404063/chr6:5404774) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
![]() |
![]() |
Hgene | Tgene |
E2F3 | FARS2 |
FUNCTION: Transcription activator that binds DNA cooperatively with DP proteins through the E2 recognition site, 5'-TTTC[CG]CGC-3' found in the promoter region of a number of genes whose products are involved in cell cycle regulation or in DNA replication. The DRTF1/E2F complex functions in the control of cell-cycle progression from G1 to S phase. E2F3 binds specifically to RB1 in a cell-cycle dependent manner. Inhibits adipogenesis, probably through the repression of CEBPA binding to its target gene promoters (By similarity). {ECO:0000250|UniProtKB:O35261}. | FUNCTION: Is responsible for the charging of tRNA(Phe) with phenylalanine in mitochondrial translation. To a lesser extent, also catalyzes direct attachment of m-Tyr (an oxidized version of Phe) to tRNA(Phe), thereby opening the way for delivery of the misacylated tRNA to the ribosome and incorporation of ROS-damaged amino acid into proteins. {ECO:0000269|PubMed:19549855, ECO:0000269|PubMed:22833457}. |
![]() |
- Retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Tgene | FARS2 | chr6:20404063 | chr6:5404774 | ENST00000274680 | 1 | 7 | 358_450 | 204.0 | 452.0 | Domain | FDX-ACB | |
Tgene | FARS2 | chr6:20404063 | chr6:5404774 | ENST00000324331 | 1 | 7 | 358_450 | 204.0 | 452.0 | Domain | FDX-ACB |
- Not-retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Hgene | E2F3 | chr6:20404063 | chr6:5404774 | ENST00000346618 | + | 1 | 7 | 120_129 | 0 | 466.0 | Compositional bias | Note=Poly-Gly |
Hgene | E2F3 | chr6:20404063 | chr6:5404774 | ENST00000346618 | + | 1 | 7 | 26_31 | 0 | 466.0 | Compositional bias | Note=Poly-Ala |
Hgene | E2F3 | chr6:20404063 | chr6:5404774 | ENST00000346618 | + | 1 | 7 | 45_53 | 0 | 466.0 | Compositional bias | Note=Poly-Ala |
Hgene | E2F3 | chr6:20404063 | chr6:5404774 | ENST00000535432 | + | 1 | 7 | 120_129 | 6.0 | 335.0 | Compositional bias | Note=Poly-Gly |
Hgene | E2F3 | chr6:20404063 | chr6:5404774 | ENST00000535432 | + | 1 | 7 | 26_31 | 6.0 | 335.0 | Compositional bias | Note=Poly-Ala |
Hgene | E2F3 | chr6:20404063 | chr6:5404774 | ENST00000535432 | + | 1 | 7 | 45_53 | 6.0 | 335.0 | Compositional bias | Note=Poly-Ala |
Hgene | E2F3 | chr6:20404063 | chr6:5404774 | ENST00000346618 | + | 1 | 7 | 155_245 | 0 | 466.0 | DNA binding | Ontology_term=ECO:0000255 |
Hgene | E2F3 | chr6:20404063 | chr6:5404774 | ENST00000535432 | + | 1 | 7 | 155_245 | 6.0 | 335.0 | DNA binding | Ontology_term=ECO:0000255 |
Hgene | E2F3 | chr6:20404063 | chr6:5404774 | ENST00000346618 | + | 1 | 7 | 209_245 | 0 | 466.0 | Motif | Note=DEF box |
Hgene | E2F3 | chr6:20404063 | chr6:5404774 | ENST00000535432 | + | 1 | 7 | 209_245 | 6.0 | 335.0 | Motif | Note=DEF box |
Hgene | E2F3 | chr6:20404063 | chr6:5404774 | ENST00000346618 | + | 1 | 7 | 101_153 | 0 | 466.0 | Region | Cyclin A/CDK2 binding |
Hgene | E2F3 | chr6:20404063 | chr6:5404774 | ENST00000346618 | + | 1 | 7 | 204_225 | 0 | 466.0 | Region | Note=Leucine-zipper |
Hgene | E2F3 | chr6:20404063 | chr6:5404774 | ENST00000346618 | + | 1 | 7 | 246_337 | 0 | 466.0 | Region | Dimerization |
Hgene | E2F3 | chr6:20404063 | chr6:5404774 | ENST00000346618 | + | 1 | 7 | 391_465 | 0 | 466.0 | Region | Transactivation |
Hgene | E2F3 | chr6:20404063 | chr6:5404774 | ENST00000346618 | + | 1 | 7 | 432_449 | 0 | 466.0 | Region | Retinoblastoma protein binding |
Hgene | E2F3 | chr6:20404063 | chr6:5404774 | ENST00000535432 | + | 1 | 7 | 101_153 | 6.0 | 335.0 | Region | Cyclin A/CDK2 binding |
Hgene | E2F3 | chr6:20404063 | chr6:5404774 | ENST00000535432 | + | 1 | 7 | 204_225 | 6.0 | 335.0 | Region | Note=Leucine-zipper |
Hgene | E2F3 | chr6:20404063 | chr6:5404774 | ENST00000535432 | + | 1 | 7 | 246_337 | 6.0 | 335.0 | Region | Dimerization |
Hgene | E2F3 | chr6:20404063 | chr6:5404774 | ENST00000535432 | + | 1 | 7 | 391_465 | 6.0 | 335.0 | Region | Transactivation |
Hgene | E2F3 | chr6:20404063 | chr6:5404774 | ENST00000535432 | + | 1 | 7 | 432_449 | 6.0 | 335.0 | Region | Retinoblastoma protein binding |
Tgene | FARS2 | chr6:20404063 | chr6:5404774 | ENST00000274680 | 1 | 7 | 157_160 | 204.0 | 452.0 | Region | Note=Substrate binding | |
Tgene | FARS2 | chr6:20404063 | chr6:5404774 | ENST00000274680 | 1 | 7 | 186_188 | 204.0 | 452.0 | Region | Note=Substrate binding | |
Tgene | FARS2 | chr6:20404063 | chr6:5404774 | ENST00000274680 | 1 | 7 | 193_195 | 204.0 | 452.0 | Region | Note=Substrate binding | |
Tgene | FARS2 | chr6:20404063 | chr6:5404774 | ENST00000324331 | 1 | 7 | 157_160 | 204.0 | 452.0 | Region | Note=Substrate binding | |
Tgene | FARS2 | chr6:20404063 | chr6:5404774 | ENST00000324331 | 1 | 7 | 186_188 | 204.0 | 452.0 | Region | Note=Substrate binding | |
Tgene | FARS2 | chr6:20404063 | chr6:5404774 | ENST00000324331 | 1 | 7 | 193_195 | 204.0 | 452.0 | Region | Note=Substrate binding |
Top |
Fusion Protein-Protein Interaction |
![]() |
![]() |
Gene | PPI interactors |
![]() |
Gene | STRING network |
E2F3 | |
FARS2 |
![]() |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
![]() |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
Related Drugs to E2F3-FARS2 |
![]() (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Drug | Source | PMID |
Top |
Related Diseases to E2F3-FARS2 |
![]() (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Disease | Source | PMID |
![]() (DisGeNet 4.0) |
Partner | Gene | Disease ID | Disease name | # pubmeds | Source |