UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
![]() |
|||||||
|
Fusion Protein:EGFR-INSL4 |
Fusion Protein Summary |
![]() |
Fusion partner gene information | Fusion gene name: EGFR-INSL4 | FusionPDB ID: 25460 | FusionGDB2.0 ID: 25460 | Hgene | Tgene | Gene symbol | EGFR | INSL4 | Gene ID | 1956 | 3641 |
Gene name | epidermal growth factor receptor | insulin like 4 | |
Synonyms | ERBB|ERBB1|HER1|NISBD2|PIG61|mENA | EPIL|PLACENTIN | |
Cytomap | 7p11.2 | 9p24.1 | |
Type of gene | protein-coding | protein-coding | |
Description | epidermal growth factor receptoravian erythroblastic leukemia viral (v-erb-b) oncogene homologcell growth inhibiting protein 40cell proliferation-inducing protein 61epidermal growth factor receptor tyrosine kinase domainerb-b2 receptor tyrosine kinas | early placenta insulin-like peptideearly placenta insulin-like peptide (EPIL)insulin-like 4 (placenta)insulin-like peptide 4 | |
Modification date | 20200329 | 20200313 | |
UniProtAcc | P00533 | . | |
Ensembl transtripts involved in fusion gene | ENST ids | ENST00000463948, ENST00000275493, ENST00000342916, ENST00000344576, ENST00000420316, ENST00000442591, ENST00000455089, ENST00000454757, | ENST00000239316, |
Fusion gene scores for assessment (based on all fusion genes of FusionGDB 2.0) | * DoF score | 41 X 25 X 14=14350 | 3 X 2 X 3=18 |
# samples | 53 | 4 | |
** MAII score | log2(53/14350*10)=-4.75891456699985 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | log2(4/18*10)=1.15200309344505 effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs). DoF>8 and MAII>0 | |
Context (manual curation of fusion genes in FusionPDB) | PubMed: EGFR [Title/Abstract] AND INSL4 [Title/Abstract] AND fusion [Title/Abstract] | ||
Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) | EGFR(55087058)-INSL4(5233654), # samples:2 | ||
Anticipated loss of major functional domain due to fusion event. | EGFR-INSL4 seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. EGFR-INSL4 seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. |
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
![]() |
Partner | Gene | GO ID | GO term | PubMed ID |
Hgene | EGFR | GO:0001934 | positive regulation of protein phosphorylation | 20551055 |
Hgene | EGFR | GO:0007165 | signal transduction | 10572067 |
Hgene | EGFR | GO:0007166 | cell surface receptor signaling pathway | 7736574 |
Hgene | EGFR | GO:0007173 | epidermal growth factor receptor signaling pathway | 7736574|12435727 |
Hgene | EGFR | GO:0008283 | cell proliferation | 17115032 |
Hgene | EGFR | GO:0008284 | positive regulation of cell proliferation | 7736574 |
Hgene | EGFR | GO:0010750 | positive regulation of nitric oxide mediated signal transduction | 12828935 |
Hgene | EGFR | GO:0018108 | peptidyl-tyrosine phosphorylation | 22732145 |
Hgene | EGFR | GO:0030307 | positive regulation of cell growth | 15467833 |
Hgene | EGFR | GO:0042177 | negative regulation of protein catabolic process | 17115032 |
Hgene | EGFR | GO:0042327 | positive regulation of phosphorylation | 15082764 |
Hgene | EGFR | GO:0043406 | positive regulation of MAP kinase activity | 10572067 |
Hgene | EGFR | GO:0045739 | positive regulation of DNA repair | 17115032 |
Hgene | EGFR | GO:0045740 | positive regulation of DNA replication | 17115032 |
Hgene | EGFR | GO:0045944 | positive regulation of transcription by RNA polymerase II | 20551055 |
Hgene | EGFR | GO:0050679 | positive regulation of epithelial cell proliferation | 10572067 |
Hgene | EGFR | GO:0050999 | regulation of nitric-oxide synthase activity | 12828935 |
Hgene | EGFR | GO:0070141 | response to UV-A | 18483258 |
Hgene | EGFR | GO:0070374 | positive regulation of ERK1 and ERK2 cascade | 20551055 |
Hgene | EGFR | GO:0071392 | cellular response to estradiol stimulus | 20551055 |
Hgene | EGFR | GO:1900020 | positive regulation of protein kinase C activity | 22732145 |
Hgene | EGFR | GO:1903078 | positive regulation of protein localization to plasma membrane | 22732145 |
![]() * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
![]() |
![]() * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
![]() |
Top |
Fusion Gene Sample Information |
![]() |
![]() * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
ChimerDB4 | STAD | TCGA-BR-6706-01A | EGFR | chr7 | 55087058 | + | INSL4 | chr9 | 5233654 | + |
Top |
Fusion ORF Analysis |
![]() |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
ENST00000455089 | EGFR | chr7 | 55087058 | + | ENST00000239316 | INSL4 | chr9 | 5233654 | + | 1996 | 345 | 398 | 0 | 133 |
ENST00000342916 | EGFR | chr7 | 55087058 | + | ENST00000239316 | INSL4 | chr9 | 5233654 | + | 1985 | 334 | 472 | 83 | 129 |
ENST00000344576 | EGFR | chr7 | 55087058 | + | ENST00000239316 | INSL4 | chr9 | 5233654 | + | 1984 | 333 | 471 | 82 | 129 |
ENST00000420316 | EGFR | chr7 | 55087058 | + | ENST00000239316 | INSL4 | chr9 | 5233654 | + | 1983 | 332 | 470 | 81 | 129 |
ENST00000275493 | EGFR | chr7 | 55087058 | + | ENST00000239316 | INSL4 | chr9 | 5233654 | + | 1916 | 265 | 403 | 14 | 129 |
ENST00000442591 | EGFR | chr7 | 55087058 | + | ENST00000239316 | INSL4 | chr9 | 5233654 | + | 1899 | 248 | 386 | 0 | 129 |
![]() |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
ENST00000455089 | ENST00000239316 | EGFR | chr7 | 55087058 | + | INSL4 | chr9 | 5233654 | + | 0.044436697 | 0.95556325 |
ENST00000342916 | ENST00000239316 | EGFR | chr7 | 55087058 | + | INSL4 | chr9 | 5233654 | + | 0.040829748 | 0.9591703 |
ENST00000344576 | ENST00000239316 | EGFR | chr7 | 55087058 | + | INSL4 | chr9 | 5233654 | + | 0.044101942 | 0.9558981 |
ENST00000420316 | ENST00000239316 | EGFR | chr7 | 55087058 | + | INSL4 | chr9 | 5233654 | + | 0.036607247 | 0.9633928 |
ENST00000275493 | ENST00000239316 | EGFR | chr7 | 55087058 | + | INSL4 | chr9 | 5233654 | + | 0.025662336 | 0.9743377 |
ENST00000442591 | ENST00000239316 | EGFR | chr7 | 55087058 | + | INSL4 | chr9 | 5233654 | + | 0.021379769 | 0.9786202 |
Top |
Fusion Amino Acid Sequences |
![]() |
>FusionGDB ID_FusionGDB isoform ID_FGname_Hgene_Hchr_Hbp_Henst_Tgene_Tchr_Tbp_Tenst_length(fusion AA) seq_BP >25460_25460_1_EGFR-INSL4_EGFR_chr7_55087058_ENST00000275493_INSL4_chr9_5233654_ENST00000239316_length(amino acids)=129AA_BP=1 MRESIIFFNDGCPSDSGFFSSGDKLGMNSDVVPKACPSLLLEVDTISFFSSRARLAGQSAASSARSAAPAVPEGRIAAPRRARSGSPDQY -------------------------------------------------------------- >25460_25460_2_EGFR-INSL4_EGFR_chr7_55087058_ENST00000342916_INSL4_chr9_5233654_ENST00000239316_length(amino acids)=129AA_BP=1 MRESIIFFNDGCPSDSGFFSSGDKLGMNSDVVPKACPSLLLEVDTISFFSSRARLAGQSAASSARSAAPAVPEGRIAAPRRARSGSPDQY -------------------------------------------------------------- >25460_25460_3_EGFR-INSL4_EGFR_chr7_55087058_ENST00000344576_INSL4_chr9_5233654_ENST00000239316_length(amino acids)=129AA_BP=1 MRESIIFFNDGCPSDSGFFSSGDKLGMNSDVVPKACPSLLLEVDTISFFSSRARLAGQSAASSARSAAPAVPEGRIAAPRRARSGSPDQY -------------------------------------------------------------- >25460_25460_4_EGFR-INSL4_EGFR_chr7_55087058_ENST00000420316_INSL4_chr9_5233654_ENST00000239316_length(amino acids)=129AA_BP=1 MRESIIFFNDGCPSDSGFFSSGDKLGMNSDVVPKACPSLLLEVDTISFFSSRARLAGQSAASSARSAAPAVPEGRIAAPRRARSGSPDQY -------------------------------------------------------------- >25460_25460_5_EGFR-INSL4_EGFR_chr7_55087058_ENST00000442591_INSL4_chr9_5233654_ENST00000239316_length(amino acids)=129AA_BP=1 MRESIIFFNDGCPSDSGFFSSGDKLGMNSDVVPKACPSLLLEVDTISFFSSRARLAGQSAASSARSAAPAVPEGRIAAPRRARSGSPDQY -------------------------------------------------------------- >25460_25460_6_EGFR-INSL4_EGFR_chr7_55087058_ENST00000455089_INSL4_chr9_5233654_ENST00000239316_length(amino acids)=133AA_BP=1 MMSYLRLVHLCCWRLTPFLSFPPEPDSPGRAQPAAPGALPRPSRRVASLLPEELAPALPINTGRSQGAVRGGCGVGGEAGTRADADEVAC -------------------------------------------------------------- |
Top |
Fusion Protein Functional Features |
![]() Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr7:55087058/chr9:5233654) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
![]() |
![]() |
Hgene | Tgene |
EGFR | . |
FUNCTION: Receptor tyrosine kinase binding ligands of the EGF family and activating several signaling cascades to convert extracellular cues into appropriate cellular responses (PubMed:2790960, PubMed:10805725, PubMed:27153536). Known ligands include EGF, TGFA/TGF-alpha, AREG, epigen/EPGN, BTC/betacellulin, epiregulin/EREG and HBEGF/heparin-binding EGF (PubMed:2790960, PubMed:7679104, PubMed:8144591, PubMed:9419975, PubMed:15611079, PubMed:12297049, PubMed:27153536, PubMed:20837704, PubMed:17909029). Ligand binding triggers receptor homo- and/or heterodimerization and autophosphorylation on key cytoplasmic residues. The phosphorylated receptor recruits adapter proteins like GRB2 which in turn activates complex downstream signaling cascades. Activates at least 4 major downstream signaling cascades including the RAS-RAF-MEK-ERK, PI3 kinase-AKT, PLCgamma-PKC and STATs modules (PubMed:27153536). May also activate the NF-kappa-B signaling cascade (PubMed:11116146). Also directly phosphorylates other proteins like RGS16, activating its GTPase activity and probably coupling the EGF receptor signaling to the G protein-coupled receptor signaling (PubMed:11602604). Also phosphorylates MUC1 and increases its interaction with SRC and CTNNB1/beta-catenin (PubMed:11483589). Positively regulates cell migration via interaction with CCDC88A/GIV which retains EGFR at the cell membrane following ligand stimulation, promoting EGFR signaling which triggers cell migration (PubMed:20462955). Plays a role in enhancing learning and memory performance (By similarity). {ECO:0000250|UniProtKB:Q01279, ECO:0000269|PubMed:10805725, ECO:0000269|PubMed:11116146, ECO:0000269|PubMed:11483589, ECO:0000269|PubMed:11602604, ECO:0000269|PubMed:12297049, ECO:0000269|PubMed:12297050, ECO:0000269|PubMed:12620237, ECO:0000269|PubMed:12873986, ECO:0000269|PubMed:15374980, ECO:0000269|PubMed:15590694, ECO:0000269|PubMed:15611079, ECO:0000269|PubMed:17115032, ECO:0000269|PubMed:17909029, ECO:0000269|PubMed:19560417, ECO:0000269|PubMed:20462955, ECO:0000269|PubMed:20837704, ECO:0000269|PubMed:21258366, ECO:0000269|PubMed:27153536, ECO:0000269|PubMed:2790960, ECO:0000269|PubMed:7679104, ECO:0000269|PubMed:8144591, ECO:0000269|PubMed:9419975}.; FUNCTION: Isoform 2 may act as an antagonist of EGF action.; FUNCTION: (Microbial infection) Acts as a receptor for hepatitis C virus (HCV) in hepatocytes and facilitates its cell entry. Mediates HCV entry by promoting the formation of the CD81-CLDN1 receptor complexes that are essential for HCV entry and by enhancing membrane fusion of cells expressing HCV envelope glycoproteins. {ECO:0000269|PubMed:21516087}. | FUNCTION: Might normally function as a transcriptional repressor. EWS-fusion-proteins (EFPS) may play a role in the tumorigenic process. They may disturb gene expression by mimicking, or interfering with the normal function of CTD-POLII within the transcription initiation complex. They may also contribute to an aberrant activation of the fusion protein target genes. |
![]() |
- Retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
- Not-retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Hgene | EGFR | chr7:55087058 | chr9:5233654 | ENST00000275493 | + | 1 | 28 | 712_979 | 29.333333333333332 | 1211.0 | Domain | Protein kinase |
Hgene | EGFR | chr7:55087058 | chr9:5233654 | ENST00000342916 | + | 1 | 16 | 712_979 | 29.333333333333332 | 629.0 | Domain | Protein kinase |
Hgene | EGFR | chr7:55087058 | chr9:5233654 | ENST00000344576 | + | 1 | 16 | 712_979 | 29.333333333333332 | 706.0 | Domain | Protein kinase |
Hgene | EGFR | chr7:55087058 | chr9:5233654 | ENST00000420316 | + | 1 | 10 | 712_979 | 29.333333333333332 | 406.0 | Domain | Protein kinase |
Hgene | EGFR | chr7:55087058 | chr9:5233654 | ENST00000275493 | + | 1 | 28 | 718_726 | 29.333333333333332 | 1211.0 | Nucleotide binding | ATP |
Hgene | EGFR | chr7:55087058 | chr9:5233654 | ENST00000275493 | + | 1 | 28 | 790_791 | 29.333333333333332 | 1211.0 | Nucleotide binding | ATP |
Hgene | EGFR | chr7:55087058 | chr9:5233654 | ENST00000342916 | + | 1 | 16 | 718_726 | 29.333333333333332 | 629.0 | Nucleotide binding | ATP |
Hgene | EGFR | chr7:55087058 | chr9:5233654 | ENST00000342916 | + | 1 | 16 | 790_791 | 29.333333333333332 | 629.0 | Nucleotide binding | ATP |
Hgene | EGFR | chr7:55087058 | chr9:5233654 | ENST00000344576 | + | 1 | 16 | 718_726 | 29.333333333333332 | 706.0 | Nucleotide binding | ATP |
Hgene | EGFR | chr7:55087058 | chr9:5233654 | ENST00000344576 | + | 1 | 16 | 790_791 | 29.333333333333332 | 706.0 | Nucleotide binding | ATP |
Hgene | EGFR | chr7:55087058 | chr9:5233654 | ENST00000420316 | + | 1 | 10 | 718_726 | 29.333333333333332 | 406.0 | Nucleotide binding | ATP |
Hgene | EGFR | chr7:55087058 | chr9:5233654 | ENST00000420316 | + | 1 | 10 | 790_791 | 29.333333333333332 | 406.0 | Nucleotide binding | ATP |
Hgene | EGFR | chr7:55087058 | chr9:5233654 | ENST00000275493 | + | 1 | 28 | 688_704 | 29.333333333333332 | 1211.0 | Region | Note=Important for dimerization%2C phosphorylation and activation |
Hgene | EGFR | chr7:55087058 | chr9:5233654 | ENST00000342916 | + | 1 | 16 | 688_704 | 29.333333333333332 | 629.0 | Region | Note=Important for dimerization%2C phosphorylation and activation |
Hgene | EGFR | chr7:55087058 | chr9:5233654 | ENST00000344576 | + | 1 | 16 | 688_704 | 29.333333333333332 | 706.0 | Region | Note=Important for dimerization%2C phosphorylation and activation |
Hgene | EGFR | chr7:55087058 | chr9:5233654 | ENST00000420316 | + | 1 | 10 | 688_704 | 29.333333333333332 | 406.0 | Region | Note=Important for dimerization%2C phosphorylation and activation |
Hgene | EGFR | chr7:55087058 | chr9:5233654 | ENST00000275493 | + | 1 | 28 | 390_600 | 29.333333333333332 | 1211.0 | Repeat | Note=Approximate |
Hgene | EGFR | chr7:55087058 | chr9:5233654 | ENST00000275493 | + | 1 | 28 | 75_300 | 29.333333333333332 | 1211.0 | Repeat | Note=Approximate |
Hgene | EGFR | chr7:55087058 | chr9:5233654 | ENST00000342916 | + | 1 | 16 | 390_600 | 29.333333333333332 | 629.0 | Repeat | Note=Approximate |
Hgene | EGFR | chr7:55087058 | chr9:5233654 | ENST00000342916 | + | 1 | 16 | 75_300 | 29.333333333333332 | 629.0 | Repeat | Note=Approximate |
Hgene | EGFR | chr7:55087058 | chr9:5233654 | ENST00000344576 | + | 1 | 16 | 390_600 | 29.333333333333332 | 706.0 | Repeat | Note=Approximate |
Hgene | EGFR | chr7:55087058 | chr9:5233654 | ENST00000344576 | + | 1 | 16 | 75_300 | 29.333333333333332 | 706.0 | Repeat | Note=Approximate |
Hgene | EGFR | chr7:55087058 | chr9:5233654 | ENST00000420316 | + | 1 | 10 | 390_600 | 29.333333333333332 | 406.0 | Repeat | Note=Approximate |
Hgene | EGFR | chr7:55087058 | chr9:5233654 | ENST00000420316 | + | 1 | 10 | 75_300 | 29.333333333333332 | 406.0 | Repeat | Note=Approximate |
Hgene | EGFR | chr7:55087058 | chr9:5233654 | ENST00000275493 | + | 1 | 28 | 25_645 | 29.333333333333332 | 1211.0 | Topological domain | Extracellular |
Hgene | EGFR | chr7:55087058 | chr9:5233654 | ENST00000275493 | + | 1 | 28 | 669_1210 | 29.333333333333332 | 1211.0 | Topological domain | Cytoplasmic |
Hgene | EGFR | chr7:55087058 | chr9:5233654 | ENST00000342916 | + | 1 | 16 | 25_645 | 29.333333333333332 | 629.0 | Topological domain | Extracellular |
Hgene | EGFR | chr7:55087058 | chr9:5233654 | ENST00000342916 | + | 1 | 16 | 669_1210 | 29.333333333333332 | 629.0 | Topological domain | Cytoplasmic |
Hgene | EGFR | chr7:55087058 | chr9:5233654 | ENST00000344576 | + | 1 | 16 | 25_645 | 29.333333333333332 | 706.0 | Topological domain | Extracellular |
Hgene | EGFR | chr7:55087058 | chr9:5233654 | ENST00000344576 | + | 1 | 16 | 669_1210 | 29.333333333333332 | 706.0 | Topological domain | Cytoplasmic |
Hgene | EGFR | chr7:55087058 | chr9:5233654 | ENST00000420316 | + | 1 | 10 | 25_645 | 29.333333333333332 | 406.0 | Topological domain | Extracellular |
Hgene | EGFR | chr7:55087058 | chr9:5233654 | ENST00000420316 | + | 1 | 10 | 669_1210 | 29.333333333333332 | 406.0 | Topological domain | Cytoplasmic |
Hgene | EGFR | chr7:55087058 | chr9:5233654 | ENST00000275493 | + | 1 | 28 | 646_668 | 29.333333333333332 | 1211.0 | Transmembrane | Helical |
Hgene | EGFR | chr7:55087058 | chr9:5233654 | ENST00000342916 | + | 1 | 16 | 646_668 | 29.333333333333332 | 629.0 | Transmembrane | Helical |
Hgene | EGFR | chr7:55087058 | chr9:5233654 | ENST00000344576 | + | 1 | 16 | 646_668 | 29.333333333333332 | 706.0 | Transmembrane | Helical |
Hgene | EGFR | chr7:55087058 | chr9:5233654 | ENST00000420316 | + | 1 | 10 | 646_668 | 29.333333333333332 | 406.0 | Transmembrane | Helical |
Top |
Fusion Protein-Protein Interaction |
![]() |
![]() |
Gene | PPI interactors |
![]() |
Gene | STRING network |
EGFR | |
INSL4 |
![]() |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
![]() |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
Related Drugs to EGFR-INSL4 |
![]() (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Drug | Source | PMID |
Top |
Related Diseases to EGFR-INSL4 |
![]() (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Disease | Source | PMID |
![]() (DisGeNet 4.0) |
Partner | Gene | Disease ID | Disease name | # pubmeds | Source |